DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG17019 and Rnf34

Sequence 1:NP_001286365.1 Gene:CG17019 FlyBaseID:FBgn0033783 Length:700 Species:Drosophila melanogaster
Sequence 2:NP_085041.1 Gene:Rnf34 MGIID:2153340 Length:376 Species:Mus musculus

Alignment Length:709 Identity:137/710 (19%)
Similarity:197/710 (28%) Gaps:405/710 (57%)


  Fly     3 CESCGVEFTVFRRKRACFDCKRYYCANCIAS----RRCKRCSVFAQRPLSRTDLLKLKPKDLIFY 63
            |::||:.|:|||:|..|.|||:.:|:.|..|    |||..|.:..:....|..|::||.|||..|
Mouse    62 CKACGLSFSVFRKKHVCCDCKKDFCSLCSVSQENLRRCSTCHLLQETAFQRPQLMRLKVKDLRQY 126

  Fly    64 LQSKHISTEGCLEKEELVGLVLTHVAQVDRSRGSNASSNSPGRGQANPIDSLKQSCQNFFSNLSD 128
            |..::|.|:.|.|||:||.|||.|                .|.|..:.:||         |:|:.
Mouse   127 LLLRNIPTDTCREKEDLVDLVLCH----------------RGLGSGDDLDS---------SSLNS 166

  Fly   129 NISDSLASFDSKVTTKPPESRQPEVPTHIFEQPRVSTREIPTYASAVNGGPQHVHVQQQATTTNG 193
            :.|.:.:.|...:.                                                   
Mouse   167 SRSQTSSFFTQSLF--------------------------------------------------- 180

  Fly   194 GSQSSSSPSTSTQSSNNRDASSSSQAHVAHQEARNEEQEDAQSKSDCECSDEEIMATFSERVSIS 258
               |:.:|.::|.||                                  ...|:|          
Mouse   181 ---SNYTPPSATVSS----------------------------------FQGELM---------- 198

  Fly   259 LKTDTSGRRVNAAAEPSPVDLANVDNGPAGNTAPSPGCSKPGSSSSKADASSQSSFEELGAIGGI 323
                                                  .:.|:..|:..|..||..         
Mouse   199 --------------------------------------DRDGAFRSEVLAQVQSEI--------- 216

  Fly   324 SDESKANTDTNSSHLDQWQVLEVNRIEAVEETPTTSAADEILEVTLRSRPAVEGDDSEMGESTQA 388
               :.||||.:....|                                    :.||.|       
Mouse   217 ---ASANTDDDDDDDD------------------------------------DDDDDE------- 235

  Fly   389 LNVNQRPANPSPAFYPAVPQRTKKVTRRRSDGYLNRRYHSSDDESPVAPGGPGLSLGLSTLSEHP 453
                                                   ..|||.......||||          
Mouse   236 ---------------------------------------DDDDEQEEEEQNPGLS---------- 251

  Fly   454 EHGLHPHSHRQSCQRCGKNKTNIRRHVEKMRRHLENSQMSEEDIKRELQEFLTYLEQRTKSVDAS 518
                             |.|..                                           
Mouse   252 -----------------KKKAR------------------------------------------- 256

  Fly   519 DADSHAVSPLSVDAISVAAGGRSPDMPITPTIEFSPTQDEDIRWDDDEGIHVYAAPSDFEPTAGI 583
                                                                             
Mouse   257 ----------------------------------------------------------------- 256

  Fly   584 DSRFVNLEDFEDLKDLEGLTVKQLKEVLMLHRVDYKGCCEKQELLDRVSRLW-------KTMREC 641
                .:|.|...|:::||::|:||||:|..:.|:|.|||||.||:::|:||:       |:..|.
Mouse   257 ----ASLSDLSSLEEVEGMSVRQLKEILARNFVNYSGCCEKWELVEKVNRLYKENEENQKSYGER 317

  Fly   642 PAVEKLATDELCKICMDAPIECVFLECGHMATCTSCGKVLNECPICRQYIVRVVRFFRA 700
            ..::....|.||:|||||.|:||.||||||.|||.|||.::||||||||:||.|..|::
Mouse   318 MQLQDEEDDSLCRICMDAVIDCVLLECGHMVTCTKCGKRMSECPICRQYVVRAVHVFKS 376

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG17019NP_001286365.1 FYVE_CARP 1..42 CDD:277289 19/43 (44%)
zf-C3HC4_3 650..694 CDD:290631 33/44 (75%)
Rnf34NP_085041.1 FYVE_CARP1 59..105 CDD:277308 19/43 (44%)
zf-C3HC4_3 325..367 CDD:290631 31/42 (74%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C11662928
eggNOG 1 0.900 E1_KOG4275
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 226 1.000 Inparanoid score I3454
Isobase 1 0.950 0 Normalized mean entropy S7198
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0001869
OrthoInspector 1 1.000 T615269
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR14879
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R4872
TreeFam 1 0.960
1110.830

Return to query results.
Submit another query.