DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG17019 and RNF34

Sequence 1:NP_001286365.1 Gene:CG17019 FlyBaseID:FBgn0033783 Length:700 Species:Drosophila melanogaster
Sequence 2:NP_919247.1 Gene:RNF34 HGNCID:17297 Length:373 Species:Homo sapiens

Alignment Length:713 Identity:134/714 (19%)
Similarity:198/714 (28%) Gaps:417/714 (58%)


  Fly     3 CESCGVEFTVFRRKRACFDCKRYYCANCIA----SRRCKRCSVFAQRPLSRTDLLKLKPKDLIFY 63
            |::||:.|:|||:|..|.|||:.:|:.|..    .|||..|.:..:....|..|::||.|||..|
Human    63 CKACGLSFSVFRKKHVCCDCKKDFCSVCSVLQENLRRCSTCHLLQETAFQRPQLMRLKVKDLRQY 127

  Fly    64 LQSKHISTEGCLEKEELVGLVLTHVAQVDRSRGS----NASSNSPGRGQANPIDSLKQSCQNFFS 124
            |..::|..:.|.|||:||.|||.|     ...||    :.||.:..|.|.:...:     ::|||
Human   128 LILRNIPIDTCREKEDLVDLVLCH-----HGLGSEDDMDTSSLNSSRSQTSSFFT-----RSFFS 182

  Fly   125 NLSDNISDSLASFDSKVTTKPPESRQPEVPTHIFEQPRVSTREIPTYASAVNGGPQHVHVQQQAT 189
            |.:.. |.:::||..::......||                          :|.|  ..||.:.|
Human   183 NYTAP-SATMSSFQGELMDGDQTSR--------------------------SGVP--AQVQSEIT 218

  Fly   190 TTNGGSQSSSSPSTSTQSSNNRDASSSSQAHVAHQEARNEEQEDAQSKSDCECSDEEIMATFSER 254
            :.|            |:..::.|           .|..::|:|:|:.:                 
Human   219 SAN------------TEDDDDDD-----------DEDDDDEEENAEDR----------------- 243

  Fly   255 VSISLKTDTSGRRVNAAAEPSPVDLANVDNGPAGNTAPSPGCSKPGSSSSKADASSQSSFEELGA 319
                                                  :||.||                     
Human   244 --------------------------------------NPGLSK--------------------- 249

  Fly   320 IGGISDESKANTDTNSSHLDQWQVLEVNRIEAVEETPTTSAADEILEVTLRSRPAVEGDDSEMGE 384
                                                                             
Human   250 ----------------------------------------------------------------- 249

  Fly   385 STQALNVNQRPANPSPAFYPAVPQRTKKVTRRRSDGYLNRRYHSSDDESPVAPGGPGLSLGLSTL 449
                                                                             
Human   250 ----------------------------------------------------------------- 249

  Fly   450 SEHPEHGLHPHSHRQSCQRCGKNKTNIRRHVEKMRRHLENSQMSEEDIKRELQEFLTYLEQRTKS 514
                                           |::|                              
Human   250 -------------------------------ERVR------------------------------ 253

  Fly   515 VDASDADSHAVSPLSVDAISVAAGGRSPDMPITPTIEFSPTQDEDIRWDDDEGIHVYAAPSDFEP 579
                                                                             
Human   254 ----------------------------------------------------------------- 253

  Fly   580 TAGIDSRFVNLEDFEDLKDLEGLTVKQLKEVLMLHRVDYKGCCEKQELLDRVSRLWKTMRECPAV 644
                    .:|.|...|.|:||::|:||||:|..:.|:|.|||||.||:::|:||:|...|....
Human   254 --------ASLSDLSSLDDVEGMSVRQLKEILARNFVNYSGCCEKWELVEKVNRLYKENEENQKS 310

  Fly   645 --EKL-----ATDELCKICMDAPIECVFLECGHMATCTSCGKVLNECPICRQYIVRVVRFFRA 700
              |:|     ..|.||:|||||.|:||.||||||.|||.|||.::||||||||:||.|..|::
Human   311 YGERLQLQDEEDDSLCRICMDAVIDCVLLECGHMVTCTKCGKRMSECPICRQYVVRAVHVFKS 373

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG17019NP_001286365.1 FYVE_CARP 1..42 CDD:277289 18/43 (42%)
zf-C3HC4_3 650..694 CDD:290631 33/44 (75%)
RNF34NP_919247.1 FYVE_CARP1 60..106 CDD:277308 18/43 (42%)
RING-HC_CARP1 325..363 CDD:319620 29/38 (76%)
RING-HC finger (C3HC4-type) 326..360 CDD:319620 25/34 (74%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C11660700
eggNOG 1 0.900 E1_KOG4275
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 221 1.000 Inparanoid score I3500
Isobase 1 0.950 0 Normalized mean entropy S7198
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1361306at2759
OrthoFinder 1 1.000 FOG0001869
OrthoInspector 1 1.000 T608437
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR14879
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R4872
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
1211.840

Return to query results.
Submit another query.