DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG17019 and zgc:171740

Sequence 1:NP_001286365.1 Gene:CG17019 FlyBaseID:FBgn0033783 Length:700 Species:Drosophila melanogaster
Sequence 2:NP_001103196.1 Gene:zgc:171740 ZFINID:ZDB-GENE-071004-29 Length:273 Species:Danio rerio

Alignment Length:226 Identity:84/227 (37%)
Similarity:118/227 (52%) Gaps:50/227 (22%)


  Fly   488 ENSQMSEEDIKRELQEFLTYLEQRTKSVDASDADSHAVSPLSVDAISVAAGGRSPDMPITPTIEF 552
            |:....|||.:.|.:|   ..|:..:.|:..|.        :||......|...           
Zfish    85 EDEDEEEEDEEEEEEE---EEEEEEEEVEGGDG--------AVDGEGEEEGEEG----------- 127

  Fly   553 SPTQDEDIRWDDDEGIHVYAAPSDFEPTAGIDSRFVNLEDFEDLKDLEGLTVKQLKEVLMLHRVD 617
                |||   |::|.       :|.|.|. :.||..:|.|...::|:|||:|:||||:|..:.|:
Zfish   128 ----DED---DEEES-------TDSEETL-VHSRRASLSDLSSVEDIEGLSVRQLKEILARNFVN 177

  Fly   618 YKGCCEKQELLDRVSRLWKTMREC-------------PAVEKLATDELCKICMDAPIECVFLECG 669
            |:|||||.||:::|:.|:...|:.             ||......:.|||||||:||:||.||||
Zfish   178 YQGCCEKWELMEKVTHLFNDQRDLHNLVSNTNTEAADPAEPSGQEENLCKICMDSPIDCVLLECG 242

  Fly   670 HMATCTSCGKVLNECPICRQYIVRVVRFFRA 700
            ||.||:.|||.:|||||||||:||.|..||:
Zfish   243 HMVTCSKCGKRMNECPICRQYVVRAVHVFRS 273

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG17019NP_001286365.1 FYVE_CARP 1..42 CDD:277289
zf-C3HC4_3 650..694 CDD:290631 33/44 (75%)
zgc:171740NP_001103196.1 zf-C3HC4_3 222..264 CDD:290631 31/42 (74%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C11659402
eggNOG 1 0.900 E1_KOG4275
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1361306at2759
OrthoFinder 1 1.000 FOG0001869
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR14879
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
76.810

Return to query results.
Submit another query.