DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG17019 and Rffl

Sequence 1:NP_001286365.1 Gene:CG17019 FlyBaseID:FBgn0033783 Length:700 Species:Drosophila melanogaster
Sequence 2:NP_001158041.1 Gene:Rffl MGIID:1914588 Length:398 Species:Mus musculus

Alignment Length:718 Identity:151/719 (21%)
Similarity:197/719 (27%) Gaps:421/719 (59%)


  Fly     3 CESCGVEFTVFRRKRACFDCKRYYCANCIAS-----RRCKRCSVFAQRPLSRTDLLKLKPKDLIF 62
            |::|||.|....||:.|.|||:.:|..|.:.     |.|..|..|......|.:|:|:|.|||..
Mouse    82 CKACGVHFASTTRKQTCLDCKKNFCMTCSSQEGNGPRLCLLCLRFRATAFQREELMKMKVKDLRD 146

  Fly    63 YLQSKHISTEGCLEKEELVGLVLTH---VAQVDRSRGSNASSNSPGRGQANPIDSLKQSCQNFFS 124
            ||....||||.|.||||||.|||..   :::.||:|       .|...||.|             
Mouse   147 YLSLHDISTEMCREKEELVFLVLGQQPVISEADRTR-------VPHLPQAFP------------- 191

  Fly   125 NLSDNISDSLASFDSKVTTKPPESRQPEVPTHIFEQPRVSTREIPTYASAVNGGPQHVHVQQQAT 189
                                                                        :|||.
Mouse   192 ------------------------------------------------------------EQQAF 196

  Fly   190 TTNGGSQSSSSPSTSTQSSNNRDASSSSQAHVAHQEARNEEQEDAQSKSDCECSDEEIMATFSER 254
            .|.  .|:|:.|.||                                                  
Mouse   197 LTQ--PQTSTVPPTS-------------------------------------------------- 209

  Fly   255 VSISLKTDTSGRRVNAAAEPSPVDLANVDNGPAGNTAPSPGCSKPGSSSSKADASSQSSFEELGA 319
                                                        ||..||.|..:|         
Mouse   210 --------------------------------------------PGLPSSPAQVTS--------- 221

  Fly   320 IGGISDESKANTDTNSSHLDQWQVLEVNRIEAVEETPTTSAADEILEVTLRSRPAVEGDDSEMGE 384
                                                 ...|.|:                    |
Mouse   222 -------------------------------------VPLAQDQ--------------------E 229

  Fly   385 STQALNVNQRPANPSPAFYPAVPQRTKKVTRRRSDGYLNRRYHSSDDESPVAPGGPGLSLGLSTL 449
            :.||:                              |::     |.|.|.|:.|            
Mouse   230 TQQAV------------------------------GHV-----SQDHEEPIFP------------ 247

  Fly   450 SEHPEHGLHPHSHRQSCQRCGKNKTNIRRHVEKMRRHLENSQMSEEDIKRELQEFLTYLEQRTKS 514
                          :|..|                                     ...|..|:|
Mouse   248 --------------ESTAR-------------------------------------VPTEDETQS 261

  Fly   515 VDASDADSHAVSPLSVDAISVAAGGRSPDMPITPTIEFSPTQDEDIRWDDDEGIHVYAAPSDFEP 579
            ||:.|:                                                        |.|
Mouse   262 VDSEDS--------------------------------------------------------FVP 270

  Fly   580 TAGIDSRFVNLEDFEDLKDLEGLTVKQLKEVLMLHRVDYKGCCEKQELLDRVSRLWKTMRECP-- 642
                 .|..:|.|...|:|:|||||:||||:|..:.|:|||||||.||::||:||:|..:...  
Mouse   271 -----GRRASLSDLTHLEDIEGLTVRQLKEILARNFVNYKGCCEKWELMERVTRLYKDQKGLQHL 330

  Fly   643 ----------AVEKLATDELCKICMDAPIECVFLECGHMATCTSCGKVLNECPICRQYIVRVVRF 697
                      ||.....:.|||||||:||:||.||||||.|||.|||.:|||||||||::|.|..
Mouse   331 VSGNEDQNGGAVPSGLEENLCKICMDSPIDCVLLECGHMVTCTKCGKRMNECPICRQYVIRAVHV 395

  Fly   698 FRA 700
            ||:
Mouse   396 FRS 398

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG17019NP_001286365.1 FYVE_CARP 1..42 CDD:277289 16/44 (36%)
zf-C3HC4_3 650..694 CDD:290631 33/44 (75%)
RfflNP_001158041.1 FYVE_CARP2 79..127 CDD:277309 17/45 (38%)
zf-C3HC4_3 347..391 CDD:290631 32/44 (73%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C11659146
eggNOG 1 0.900 E1_KOG4275
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 226 1.000 Inparanoid score I3454
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1361306at2759
OrthoFinder 1 1.000 FOG0001869
OrthoInspector 1 1.000 T615269
orthoMCL 1 0.900 OOG5_135289
Panther 1 1.100 LDO PTHR14879
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R4872
TreeFam 1 0.960
1211.790

Return to query results.
Submit another query.