DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17019 and APD4

DIOPT Version :9

Sequence 1:NP_001286365.1 Gene:CG17019 / 36425 FlyBaseID:FBgn0033783 Length:700 Species:Drosophila melanogaster
Sequence 2:NP_001118468.1 Gene:APD4 / 6240532 AraportID:AT2G38195 Length:399 Species:Arabidopsis thaliana


Alignment Length:388 Identity:90/388 - (23%)
Similarity:141/388 - (36%) Gaps:89/388 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   350 EAVEETPTTSAADEILEVTLRSRPAVEGDDSEMGESTQALNVNQRPANPSPAFYPAVPQRTKKVT 414
            |.|...|.:|...:...:.::|..|.|.|.|:.|......|   ..:.||..|......|...|:
plant    64 ETVWLGPNSSILVKPSSIFVKSINAKELDFSKPGLQLYGFN---GQSTPSGYFVNWTESRVLSVS 125

  Fly   415 RRRSDG---YLNRRYHSSDDESPVAPGGPGLSLGLSTLSEHPEHGLHPHSHRQSCQRCGKNKT-- 474
            :....|   ||||..|.:...: :.|.|..:.|.::       .|: |..:|.|.:......|  
plant   126 QNSYKGWPYYLNRGTHMNISYN-ILPKGSAVRLVIT-------EGM-PFFYRSSLKDIAFRDTAW 181

  Fly   475 --NIRRHVEKMRRHLENSQMSEEDIKRELQEFLTYLEQRTKSVDAS-DADSHAV----------S 526
              |:          ::.|.|.:.||.:....:||....:.|.|:.. |.|...|          .
plant   182 SWNL----------IQGSGMIQLDISKSKGYYLTVANLKRKDVEVELDIDVKVVLYDTKQSSYNC 236

  Fly   527 PLSVDAISVAAGGRSPDMPITPTIE-----FSPTQDEDIRWDDDEGIHVYAAPSDFEPTAGIDSR 586
            ..|....|.....|||       :|     .||...:.:..||:..|.:     .::|      |
plant   237 SFSNGECSFKMNERSP-------VENYAVVTSPALGQGVSIDDEWYIEL-----SYQP------R 283

  Fly   587 FVNLEDFEDLKDLEGLTVKQLKEVLMLHRVDYKGCCEKQELLDRVSRLWKTMRECPAVEKLATD- 650
            .:....|      .|:.:..:  ::.:|..:...||..:..|....    ::|.|...:|...| 
plant   284 LIAYGSF------TGVLLSFM--LVAIHFCNKLKCCGGEGFLSEDD----SVRTCLLADKGDNDC 336

  Fly   651 ---------ELCKICMDAPIECVFLECGHMATCTSCG----KVLNECPICRQYIVRVVRFFRA 700
                     .||.||.|||.:|.||.|||..:|..||    :....|||||:.|:.|.|.:.|
plant   337 CNDVEASNKSLCAICFDAPRDCCFLPCGHCVSCYQCGTKIKRTKGRCPICRKKIMHVKRIYTA 399

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17019NP_001286365.1 FYVE_CARP 1..42 CDD:277289
zf-C3HC4_3 650..694 CDD:290631 23/57 (40%)
APD4NP_001118468.1 DUF4792 98..162 CDD:374322 15/74 (20%)
DUF4793 191..301 CDD:374323 25/135 (19%)
zf-C3HC4_3 344..390 CDD:372816 21/45 (47%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 53 1.000 Domainoid score I4202
eggNOG 1 0.900 - - E1_KOG4275
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1361306at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm3123
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.