DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG17019 and APD4

Sequence 1:NP_001286365.1 Gene:CG17019 FlyBaseID:FBgn0033783 Length:700 Species:Drosophila melanogaster
Sequence 2:NP_001118468.1 Gene:APD4 AraportID:AT2G38195 Length:399 Species:Arabidopsis thaliana

Alignment Length:388 Identity:90/389 (23%)
Similarity:141/389 (36%) Gaps:89/389 (23%)


  Fly   350 EAVEETPTTSAADEILEVTLRSRPAVEGDDSEMGESTQALNVNQRPANPSPAFYPAVPQRTKKVT 414
            |.|...|.:|...:...:.::|..|.|.|.|:.|......|   ..:.||..|......|...|:
plant    64 ETVWLGPNSSILVKPSSIFVKSINAKELDFSKPGLQLYGFN---GQSTPSGYFVNWTESRVLSVS 125

  Fly   415 RRRSDG---YLNRRYHSSDDESPVAPGGPGLSLGLSTLSEHPEHGLHPHSHRQSCQRCGKNKT-- 474
            :....|   ||||..|.:...: :.|.|..:.|.::       .|: |..:|.|.:......|  
plant   126 QNSYKGWPYYLNRGTHMNISYN-ILPKGSAVRLVIT-------EGM-PFFYRSSLKDIAFRDTAW 181

  Fly   475 --NIRRHVEKMRRHLENSQMSEEDIKRELQEFLTYLEQRTKSVDAS-DADSHAV----------S 526
              |:          ::.|.|.:.||.:....:||....:.|.|:.. |.|...|          .
plant   182 SWNL----------IQGSGMIQLDISKSKGYYLTVANLKRKDVEVELDIDVKVVLYDTKQSSYNC 236

  Fly   527 PLSVDAISVAAGGRSPDMPITPTIE-----FSPTQDEDIRWDDDEGIHVYAAPSDFEPTAGIDSR 586
            ..|....|.....|||       :|     .||...:.:..||:..|.:     .::|      |
plant   237 SFSNGECSFKMNERSP-------VENYAVVTSPALGQGVSIDDEWYIEL-----SYQP------R 283

  Fly   587 FVNLEDFEDLKDLEGLTVKQLKEVLMLHRVDYKGCCEKQELLDRVSRLWKTMRECPAVEKLATD- 650
            .:....|      .|:.:..:  ::.:|..:...||..:..|....    ::|.|...:|...| 
plant   284 LIAYGSF------TGVLLSFM--LVAIHFCNKLKCCGGEGFLSEDD----SVRTCLLADKGDNDC 336

  Fly   651 ---------ELCKICMDAPIECVFLECGHMATCTSCG----KVLNECPICRQYIVRVVRFFRA 700
                     .||.||.|||.:|.||.|||..:|..||    :....|||||:.|:.|.|.:.|
plant   337 CNDVEASNKSLCAICFDAPRDCCFLPCGHCVSCYQCGTKIKRTKGRCPICRKKIMHVKRIYTA 399

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG17019NP_001286365.1 FYVE_CARP 1..42 CDD:277289
zf-C3HC4_3 650..694 CDD:290631 23/58 (40%)
APD4NP_001118468.1 DUF4792 97..162 CDD:292659 16/76 (21%)
DUF4793 195..300 CDD:292660 24/131 (18%)
zf-C3HC4_3 344..390 CDD:290631 21/46 (46%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1361306at2759
OrthoInspector 1 1.000 T125041
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.