DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG17019 and rffl

Sequence 1:NP_001286365.1 Gene:CG17019 FlyBaseID:FBgn0033783 Length:700 Species:Drosophila melanogaster
Sequence 2:NP_998061.1 Gene:rffl ZFINID:ZDB-GENE-040426-2274 Length:346 Species:Danio rerio

Alignment Length:715 Identity:141/716 (20%)
Similarity:191/716 (27%) Gaps:431/716 (60%)


  Fly     3 CESCGVEFTVFRRKRACFDCKRYYCANCIASRR-----CKRCSVFAQRPLSRTDLLKLKPKDLIF 62
            |:|||..|....||..|.|||:.||:.|...:.     |:.|..|....|.|.:|:|||.|||..
Zfish    46 CKSCGGRFDSLTRKHVCMDCKKSYCSQCSTQQELQPWLCRTCQRFRGILLERAELMKLKVKDLRD 110

  Fly    63 YLQSKHISTEGCLEKEELVGLVLTHVAQVDRSRGSNASSNSPGRGQANPIDSLKQSCQNFFSNLS 127
            ||....:.|:.|.||||||.|||                     ||..|                
Zfish   111 YLHLHGVPTQMCREKEELVELVL---------------------GQQTP---------------- 138

  Fly   128 DNISDSLASFDSKVTTKPPESRQPEVPTHIFEQPRVSTREIPTYASAVNGGPQHVHVQQQATTTN 192
              .||                      |||                                   
Zfish   139 --TSD----------------------THI----------------------------------- 144

  Fly   193 GGSQSSSSPSTSTQSSNNRDASSSSQAHVAHQEARNEEQEDAQSKSDCECSDEEIMATFSERVSI 257
                                                                             
Zfish   145 ----------------------------------------------------------------- 144

  Fly   258 SLKTDTSGRRVNAAAEPSPVDLANVDNGPAGNTAPSPGCSKPGSSSSKADASSQSSFEELGAIGG 322
                                              |:|                            
Zfish   145 ----------------------------------PAP---------------------------- 147

  Fly   323 ISDESKANTDTNSSHLDQWQVLEVNRIEAVEETPTTSAADEILEVTLRSRPAVEGDDSEMGESTQ 387
                       .::.|||.:.|         :||..:.:           |:...:.:|:|..||
Zfish   148 -----------ETTRLDQQETL---------DTPVITVS-----------PSGNNNTTELGPQTQ 181

  Fly   388 ALNVNQRPANPSPAFYPAVPQRTKKVTRRRSDGYLNRRYHSSDDESPVAPGGPGLSLGLSTLSEH 452
            |::..|..|               :||                                      
Zfish   182 AMDNGQSLA---------------EVT-------------------------------------- 193

  Fly   453 PEHGLHPHSHRQSCQRCGKNKTNIRRHVEKMRRHLENSQMSEEDIKRELQEFLTYLEQRTKSVDA 517
                                                    :|.::..|||     :||...|   
Zfish   194 ----------------------------------------AESEMDTELQ-----MEQEQFS--- 210

  Fly   518 SDADSHAVSPLSVDAISVAAGGRSPDMPITPTIEFSPTQDEDIRWDDDEGIHVYAAPSDFEPTAG 582
                         |:..|.|.||.                                         
Zfish   211 -------------DSEEVLAPGRR----------------------------------------- 221

  Fly   583 IDSRFVNLEDFEDLKDLEGLTVKQLKEVLMLHRVDYKGCCEKQELLDRVSRLWKTMRECPAVEKL 647
                 .:|.|...::|:|.|:|:||||:|..:.|||||||||.||::||:||:...::...:...
Zfish   222 -----ASLSDLGSVEDIEDLSVRQLKEILARNFVDYKGCCEKWELMERVTRLYNDQKDLQNMVSN 281

  Fly   648 AT------------DELCKICMDAPIECVFLECGHMATCTSCGKVLNECPICRQYIVRVVRFFRA 700
            ||            :.|||||||:||:||.||||||.|||.|||.::||||||||:||.|..||:
Zfish   282 ATEGTDTGSGTAVEENLCKICMDSPIDCVLLECGHMVTCTKCGKRMSECPICRQYVVRAVHVFRS 346

  Fly   701  700
            Zfish   347  346

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG17019NP_001286365.1 FYVE_CARP 1..42 CDD:277289 16/44 (36%)
zf-C3HC4_3 650..694 CDD:290631 33/44 (75%)
rfflNP_998061.1 FYVE_CARP2 43..91 CDD:277309 17/45 (38%)
zf-C3HC4_3 295..337 CDD:290631 31/42 (74%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C11664214
eggNOG 1 0.900 E1_KOG4275
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 215 1.000 Inparanoid score I3524
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D525183at33208
OrthoFinder 1 1.000 FOG0001869
OrthoInspector 1 1.000 T595940
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR14879
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R4872
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
1110.890

Return to query results.
Submit another query.