DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG17019 and rnf34a

Sequence 1:NP_001286365.1 Gene:CG17019 FlyBaseID:FBgn0033783 Length:700 Species:Drosophila melanogaster
Sequence 2:XP_005172521.1 Gene:rnf34a ZFINID:ZDB-GENE-030131-6135 Length:377 Species:Danio rerio

Alignment Length:731 Identity:136/732 (19%)
Similarity:185/732 (25%) Gaps:448/732 (61%)


  Fly     3 CESCGVEFTVFRRKRACFDCKRYYCANCIA----SRRCKRCSVFAQRPLSRTDLLKLKPKDLIFY 63
            |::|...|:||||:..|.||.:.:|:.|..    .|||..|.:.......|:.|::|:.|||..|
Zfish    62 CQACRQAFSVFRRRYICCDCTKSFCSLCSVLQENLRRCTTCHLLKGTAFQRSQLMRLRVKDLRQY 126

  Fly    64 LQSKHISTEGCLEKEELVGLVLTHVAQVDRSRGSNASSNSPGRGQANPIDSLKQSCQNFFSNLSD 128
            |..::|:|:.|.|||:||.|||.|     ....|....::|.. |::|:.|              
Zfish   127 LMLRNINTDTCREKEDLVDLVLCH-----HGAESEDDPDTPSL-QSHPLYS-------------- 171

  Fly   129 NISDSLASFDSKVTTKPPESRQPEVPTHIFEQPRVSTREIPTYASAVNGGPQHVHVQQQATTTNG 193
                           .||...:|..|.....    .||| |.                       
Zfish   172 ---------------PPPLIEEPTSPLSALS----PTRE-PI----------------------- 193

  Fly   194 GSQSSSSPSTSTQSSNNRDASSSSQAHVAHQEARNEEQEDAQSKSDCECSDEEIMATFSERVSIS 258
             |:|:||.||                        |::.||:.|                      
Zfish   194 -SRSNSSEST------------------------NQDIEDSTS---------------------- 211

  Fly   259 LKTDTSGRRVNAAAEPSPVDLANVDNGPAGNTAPSPGCSKPGSSSSKADASSQSSFEELGAIGGI 323
                              |.|.|:|.                                       
Zfish   212 ------------------VSLLNLDQ--------------------------------------- 219

  Fly   324 SDESKANTDTNSSHLDQWQVLEVNRIEAVEETPTTSAADEILEVTLRSRPAVEGDDSEMGESTQA 388
                                        .|.||..|                             
Zfish   220 ----------------------------TEHTPEVS----------------------------- 227

  Fly   389 LNVNQRPANPSPAFYPAVPQRTKKVTRRRSDGYLNRRYHSSDDESPVAPGGPGLSLGLSTLSEHP 453
                              ||     ||||:.                                  
Zfish   228 ------------------PQ-----TRRRAR---------------------------------- 235

  Fly   454 EHGLHPHSHRQSCQRCGKNKTNIRRHVEKMRRHLENSQMSEEDIKRELQEFLTYLEQRTKSVDAS 518
                                                                             
Zfish   236 ----------------------------------------------------------------- 235

  Fly   519 DADSHAVSPLSVDAISVAAGGRSPDMPITPTIEFSPTQDEDIRWDDDEGIHVYAAPSDFEPTAGI 583
                                                                             
Zfish   236 ----------------------------------------------------------------- 235

  Fly   584 DSRFVNLEDFEDLKDLEGLTVKQLKEVLMLHRVDYKGCCEKQELLDRVSRLW-------KTMREC 641
                .:|.|...|.|:|.|||:||||:|..:.|.:.|||||.||::||.||:       |:|...
Zfish   236 ----ASLSDLSSLDDVEQLTVRQLKEILARNFVSFSGCCEKWELVERVRRLYRENEDNRKSMENV 296

  Fly   642 --PAVEKLA--------------------TDELCKICMDAPIECVFLECGHMATCTSCGKVLNEC 684
              |....:|                    .|.||:|||||.|:||.||||||.|||.|||.::||
Zfish   297 SNPITAVVAYPPPICNGGIGDSCRTQLSNDDNLCRICMDAVIDCVLLECGHMVTCTKCGKRMSEC 361

  Fly   685 PICRQYIVRVVRFFRA 700
            ||||||::|.|..|::
Zfish   362 PICRQYVIRAVHVFKS 377

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG17019NP_001286365.1 FYVE_CARP 1..42 CDD:277289 16/43 (37%)
zf-C3HC4_3 650..694 CDD:290631 32/44 (73%)
rnf34aXP_005172521.1 PHD_SF 59..105 CDD:304600 16/43 (37%)
zf-C3HC4_3 326..370 CDD:290631 31/44 (70%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C11658294
eggNOG 1 0.900 E1_KOG4275
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1361306at2759
OrthoFinder 1 1.000 FOG0001869
OrthoInspector 1 1.000 T595940
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR14879
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
98.810

Return to query results.
Submit another query.