DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG17019 and Rnf34

Sequence 1:NP_001286365.1 Gene:CG17019 FlyBaseID:FBgn0033783 Length:700 Species:Drosophila melanogaster
Sequence 2:XP_006249422.1 Gene:Rnf34 RGDID:628636 Length:405 Species:Rattus norvegicus

Alignment Length:713 Identity:137/714 (19%)
Similarity:202/714 (28%) Gaps:408/714 (57%)


  Fly     3 CESCGVEFTVFRRKRACFDCKRYYCANCIAS----RRCKRCSVFAQRPLSRTDLLKLKPKDLIFY 63
            |::||:.|:|||:|..|.|||:.:|:.|..|    |||..|.:..:....|..|::||.|||..|
  Rat    86 CKACGLSFSVFRKKHVCCDCKKDFCSLCSVSQENLRRCSTCHLLQETAFQRPQLMRLKVKDLRQY 150

  Fly    64 LQSKHISTEGCLEKEELVGLVLTHVAQVDRSRGS----NASSNSPGRGQANPIDSLKQSCQNFFS 124
            |..:::.|:.|.|||:||.|||.|     |..||    ::.|.|..|.|.:...:     |::||
  Rat   151 LLLRNVPTDTCREKEDLVDLVLCH-----RGLGSGDGLDSRSLSSSRSQTSSFFT-----QSYFS 205

  Fly   125 NLSDNISDSLASFDSKVTTKPPESRQPEVPTHIFEQPRVSTREIPTYASAVNGGPQHVHVQQQAT 189
            |.:.. |.:::||..::..:....|. ||.|.:                                
  Rat   206 NYTPP-SATVSSFQGELMDREGTFRS-EVLTQV-------------------------------- 236

  Fly   190 TTNGGSQSSSSPSTSTQSSNNRDASSSSQAHVAHQEARNEEQEDAQSKSDCECSDEEIMATFSER 254
                                        |:.:|   :.|.:.||.:...|.:..|:         
  Rat   237 ----------------------------QSELA---SANTDDEDGEEDDDDDDDDD--------- 261

  Fly   255 VSISLKTDTSGRRVNAAAEPSPVDLANVDNGPAGNTAPSPGCSKPGSSSSKADASSQSSFEELGA 319
                                                                             
  Rat   262 ----------------------------------------------------------------- 261

  Fly   320 IGGISDESKANTDTNSSHLDQWQVLEVNRIEAVEETPTTSAADEILEVTLRSRPAVEGDDSEMGE 384
                                                      ||              ||.|..|
  Rat   262 ------------------------------------------DE--------------DDDEQEE 270

  Fly   385 STQALNVNQRPANPSPAFYPAVPQRTKKVTRRRSDGYLNRRYHSSDDESPVAPGGPGLSLGLSTL 449
            :.:..|                                                 ||||      
  Rat   271 NLEEQN-------------------------------------------------PGLS------ 280

  Fly   450 SEHPEHGLHPHSHRQSCQRCGKNKTNIRRHVEKMRRHLENSQMSEEDIKRELQEFLTYLEQRTKS 514
                                 |.|..                                       
  Rat   281 ---------------------KKKAR--------------------------------------- 285

  Fly   515 VDASDADSHAVSPLSVDAISVAAGGRSPDMPITPTIEFSPTQDEDIRWDDDEGIHVYAAPSDFEP 579
                                                                             
  Rat   286 ----------------------------------------------------------------- 285

  Fly   580 TAGIDSRFVNLEDFEDLKDLEGLTVKQLKEVLMLHRVDYKGCCEKQELLDRVSRLW-------KT 637
                    .:|.|...|:::||::|:||||:|..:.|:|.|||||.||:::|:||:       |:
  Rat   286 --------ASLSDLSSLEEVEGMSVRQLKEILARNFVNYSGCCEKWELVEKVNRLYKENEENQKS 342

  Fly   638 MRECPAVEKLATDELCKICMDAPIECVFLECGHMATCTSCGKVLNECPICRQYIVRVVRFFRA 700
            ..|...::....|.||:|||||.|:||.||||||.|||.|||.::||||||||:||.|..|::
  Rat   343 YGERMQLQDEEDDSLCRICMDAVIDCVLLECGHMVTCTKCGKRMSECPICRQYVVRAVHVFKS 405

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG17019NP_001286365.1 FYVE_CARP 1..42 CDD:277289 19/43 (44%)
zf-C3HC4_3 650..694 CDD:290631 33/44 (75%)
Rnf34XP_006249422.1 FYVE_CARP1 83..129 CDD:277308 19/43 (44%)
zf-C3HC4_3 354..396 CDD:290631 31/42 (74%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C11661343
eggNOG 1 0.900 E1_KOG4275
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 224 1.000 Inparanoid score I3370
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1361306at2759
OrthoFinder 1 1.000 FOG0001869
OrthoInspector 1 1.000 T617376
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR14879
Phylome 1 0.910 0.667 Consistency score
TreeFam 1 0.960
109.860

Return to query results.
Submit another query.