DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG17019 and Rffl

Sequence 1:NP_001286365.1 Gene:CG17019 FlyBaseID:FBgn0033783 Length:700 Species:Drosophila melanogaster
Sequence 2:XP_006247031.1 Gene:Rffl RGDID:727916 Length:398 Species:Rattus norvegicus

Alignment Length:719 Identity:152/720 (21%)
Similarity:202/720 (28%) Gaps:423/720 (59%)


  Fly     3 CESCGVEF-TVFRRKRACFDCKRYYCANCIAS-----RRCKRCSVFAQRPLSRTDLLKLKPKDLI 61
            |::|||.| :..|:::.|.|||:.:|..|.:.     |.|..|..|......|.:|:|:|.|||.
  Rat    82 CKACGVHFASTTRKQQTCLDCKKNFCMTCSSQEGNGPRLCLLCLRFRATAFQREELMKMKVKDLR 146

  Fly    62 FYLQSKHISTEGCLEKEELVGLVLTH---VAQVDRSRGSNASSNSPGRGQANPIDSLKQSCQNFF 123
            .||....||||.|.||||||.|||..   :::.||:|       :|...||.|            
  Rat   147 DYLSLHDISTEMCREKEELVFLVLGQQPVISEADRTR-------APTLPQAFP------------ 192

  Fly   124 SNLSDNISDSLASFDSKVTTKPPESRQPEVPTHIFEQPRVSTREIPTYASAVNGGPQHVHVQQQA 188
                                                                         :|||
  Rat   193 -------------------------------------------------------------EQQA 196

  Fly   189 TTTNGGSQSSSSPSTSTQSSNNRDASSSSQAHVAHQEARNEEQEDAQSKSDCECSDEEIMATFSE 253
            ..|.  .|||:.|.||                                                 
  Rat   197 FLTQ--PQSSTVPPTS------------------------------------------------- 210

  Fly   254 RVSISLKTDTSGRRVNAAAEPSPVDLANVDNGPAGNTAPSPGCSKPGSSSSKADASSQSSFEELG 318
                                                         ||..||.|..:|        
  Rat   211 ---------------------------------------------PGLPSSPAQVTS-------- 222

  Fly   319 AIGGISDESKANTDTNSSHLDQWQVLEVNRIEAVEETPTTSAADEILEVTLRSRPAVEGDDSEMG 383
                                    ||               |.|:                    
  Rat   223 ------------------------VL---------------AQDQ-------------------- 228

  Fly   384 ESTQALNVNQRPANPSPAFYPAVPQRTKKVTRRRSDGYLNRRYHSSDDESPVAPGGPGLSLGLST 448
            |:.||:                              |::     |.|.|.|:.         |.:
  Rat   229 ETQQAI------------------------------GHV-----SQDHEEPIF---------LES 249

  Fly   449 LSEHPEHGLHPHSHRQSCQRCGKNKTNIRRHVEKMRRHLENSQMSEEDIKRELQEFLTYLEQRTK 513
            .:..|.                                                      |..|:
  Rat   250 TARVPP------------------------------------------------------EDETQ 260

  Fly   514 SVDASDADSHAVSPLSVDAISVAAGGRSPDMPITPTIEFSPTQDEDIRWDDDEGIHVYAAPSDFE 578
            |||:.|:                                                        |.
  Rat   261 SVDSEDS--------------------------------------------------------FV 269

  Fly   579 PTAGIDSRFVNLEDFEDLKDLEGLTVKQLKEVLMLHRVDYKGCCEKQELLDRVSRLWKTMRECP- 642
            |     .|..:|.|...|:|:|||||:||||:|..:.|:|||||||.||::||:||:|..:... 
  Rat   270 P-----GRRASLSDLTHLEDIEGLTVRQLKEILARNFVNYKGCCEKWELMERVTRLYKDQKGLQH 329

  Fly   643 -----------AVEKLATDELCKICMDAPIECVFLECGHMATCTSCGKVLNECPICRQYIVRVVR 696
                       ||.....:.|||||||:||:||.||||||.|||.|||.:|||||||||::|.|.
  Rat   330 LVSGNEDQNGGAVPSGLEENLCKICMDSPIDCVLLECGHMVTCTKCGKRMNECPICRQYVIRAVH 394

  Fly   697 FFRA 700
            .||:
  Rat   395 VFRS 398

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG17019NP_001286365.1 FYVE_CARP 1..42 CDD:277289 15/45 (33%)
zf-C3HC4_3 650..694 CDD:290631 33/44 (75%)
RfflXP_006247031.1 PHD_SF 79..128 CDD:304600 16/46 (35%)
RseA_C 193..242 CDD:281818 26/247 (11%)
zf-C3HC4_3 347..391 CDD:290631 32/44 (73%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C11662979
eggNOG 1 0.900 E1_KOG4275
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 224 1.000 Inparanoid score I3370
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1361306at2759
OrthoFinder 1 1.000 FOG0001869
OrthoInspector 1 1.000 T617376
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR14879
Phylome 1 0.910 0.667 Consistency score
TreeFam 1 0.960
109.860

Return to query results.
Submit another query.