DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG17019 and K11D12.9

Sequence 1:NP_001286365.1 Gene:CG17019 FlyBaseID:FBgn0033783 Length:700 Species:Drosophila melanogaster
Sequence 2:NP_504354.1 Gene:K11D12.9 WormBaseID:WBGene00019649 Length:400 Species:Caenorhabditis elegans

Alignment Length:508 Identity:99/509 (19%)
Similarity:183/509 (36%) Gaps:132/509 (26%)


  Fly   212 DASSSSQAHVAHQEARNEEQEDAQSKSDCECSDEEI--MATFSERVSISLKTDTSGRRVNAAAEP 274
            |.|...|..:|.:...|:|:..:..|::.:...:|.  ...|...:.|..|....|...::....
 Worm     3 DLSIHDQIKLASEWGYNQEEIISALKANSKEGSKEFERFENFDVMLDILNKVTGKGDSRSSRKHN 67

  Fly   275 SPVDLANVDNGPAGNTAPSPGCSKP------GSSSS---KADASSQSSFEELGAIGGISDESKAN 330
            ||.||.:     :..|:..|..||.      |.|||   ....|::.|.:.:..:..:..|.:.:
 Worm    68 SPGDLMS-----SSVTSLHPHSSKSHRNLSVGRSSSFHLSTPRSTRDSHDIVRLLATLEREKERD 127

  Fly   331 TDTNSSHLDQWQVLEVNRIEAVEETPTTSAADEILEVTLRSRPAVEGDDSEMGESTQALN--VNQ 393
            .....|   |:.:|: |||..:|     :..::.|......:..:|..:.::.:....:|  :.:
 Worm   128 RKEVDS---QFTILK-NRINHLE-----NEKEQCLSEVQELKRLLEDSEQDLKDCKDEMNRLMEE 183

  Fly   394 RPANPSPAFYPAVPQRTKKVTRRRSDGYLNRRYHSSDDESPVAPGGPGLSLGLSTLSEHPEHGLH 458
            |.....     |:.:.|.:..|::.:      .|...:                 ||||      
 Worm   184 RVETAD-----ALDKLTIQNYRQQQE------IHDQKE-----------------LSEH------ 214

  Fly   459 PHSHRQSCQRCGKNKTNIRRHV---EKMRRHLE--NSQMSEEDIKRELQEFLTYLEQRTKSVDAS 518
                              |:.:   ||.|:..|  |.|..:.|::.||:.....|:::|......
 Worm   215 ------------------RKKIYSEEKARKDEEILNLQKQKTDVEMELERKSNLLDEQTNVTKRM 261

  Fly   519 DADSHAVSPL-SVDAISVAAGGRSPDMPITPTIEFSPTQDEDIRWDDDEGIHVYAAPSDFEPTAG 582
            :..|:.:.|| .:|.::     :.....:..:.||.|              ::.|.         
 Worm   262 EEKSYQLKPLVLLDELT-----KKHSQLVDLSTEFLP--------------NINAV--------- 298

  Fly   583 IDSRFVNLEDFEDLKDLEGLTVKQLKEVLMLHRVDYKGCCEKQELLDRVSRLWKTMRECPAVEKL 647
               :.:..|.||....||  |.....::.|..||:     |.:|.|...:|.::.::     |||
 Worm   299 ---KMLYKELFESFPQLE--TNVHESKLSMERRVE-----EVEEQLRSRNRDFQRLQ-----EKL 348

  Fly   648 ATDELCKICMDAPIECVFLECGHMATCTSC--GKVLNECPICRQYIVRVVRFF 698
            ..:  |.||:......||:.|.|:.||:.|  .....|||.||..|...:..|
 Worm   349 VAE--CCICLATKPSIVFMPCRHLITCSGCYDASDFRECPTCRSTIENSITVF 399

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG17019NP_001286365.1 FYVE_CARP 1..42 CDD:277289
zf-C3HC4_3 650..694 CDD:290631 16/46 (35%)
K11D12.9NP_504354.1 SYCE1 138..>245 CDD:291886 27/165 (16%)
zf-C3HC4_3 351..393 CDD:290631 16/44 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 T374989
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.