DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG17019 and RFFL

Sequence 1:NP_001286365.1 Gene:CG17019 FlyBaseID:FBgn0033783 Length:700 Species:Drosophila melanogaster
Sequence 2:NP_001017368.1 Gene:RFFL HGNCID:24821 Length:363 Species:Homo sapiens

Alignment Length:718 Identity:153/719 (21%)
Similarity:200/719 (28%) Gaps:421/719 (59%)


  Fly     3 CESCGVEFTVFRRKRACFDCKRYYCANCIAS-----RRCKRCSVFAQRPLSRTDLLKLKPKDLIF 62
            |:|||..|....||:.|.|||:.:|..|.:.     |.|..|..|......|.:|:|:|.|||..
Human    47 CKSCGAHFANTARKQTCLDCKKNFCMTCSSQVGNGPRLCLLCQRFRATAFQREELMKMKVKDLRD 111

  Fly    63 YLQSKHISTEGCLEKEELVGLVLTH---VAQVDRSRGSNASSNSPGRGQANPIDSLKQSCQNFFS 124
            ||....||||.|.||||||.|||..   ::|.||:|.|..|                        
Human   112 YLSLHDISTEMCREKEELVLLVLGQQPVISQEDRTRASTLS------------------------ 152

  Fly   125 NLSDNISDSLASFDSKVTTKPPESRQPEVPTHIFEQPRVSTREIPTYASAVNGGPQHVHVQQQAT 189
                                      |:.|                              :|||.
Human   153 --------------------------PDFP------------------------------EQQAF 161

  Fly   190 TTNGGSQSSSSPSTSTQSSNNRDASSSSQAHVAHQEARNEEQEDAQSKSDCECSDEEIMATFSER 254
            .|.  ..||..|.||                                                  
Human   162 LTQ--PHSSMVPPTS-------------------------------------------------- 174

  Fly   255 VSISLKTDTSGRRVNAAAEPSPVDLANVDNGPAGNTAPSPGCSKPGSSSSKADASSQSSFEELGA 319
                                                        |...||.|.|:|         
Human   175 --------------------------------------------PNLPSSSAQATS--------- 186

  Fly   320 IGGISDESKANTDTNSSHLDQWQVLEVNRIEAVEETPTTSAADEILEVTLRSRPAVEGDDSEMGE 384
                                               .|                ||      ::.|
Human   187 -----------------------------------VP----------------PA------QVQE 194

  Fly   385 STQALNVNQRPANPSPAFYPAVPQRTKKVTRRRSDGYLNRRYHSSDDESPVAPGGPGLSLGLSTL 449
            :.||                              :|::     |.|.|.||              
Human   195 NQQA------------------------------NGHV-----SQDQEEPV-------------- 210

  Fly   450 SEHPEHGLHPHSHRQSCQRCGKNKTNIRRHVEKMRRHLENSQMSEEDIKRELQEFLTYLEQRTKS 514
                                         ::|.:.|                    ...|..|:|
Human   211 -----------------------------YLESVAR--------------------VPAEDETQS 226

  Fly   515 VDASDADSHAVSPLSVDAISVAAGGRSPDMPITPTIEFSPTQDEDIRWDDDEGIHVYAAPSDFEP 579
            :|:.|:                                                        |.|
Human   227 IDSEDS--------------------------------------------------------FVP 235

  Fly   580 TAGIDSRFVNLEDFEDLKDLEGLTVKQLKEVLMLHRVDYKGCCEKQELLDRVSRLWKTMRECPAV 644
                 .|..:|.|..||:|:|||||:||||:|..:.|:|||||||.||::||:||:|..:....:
Human   236 -----GRRASLSDLTDLEDIEGLTVRQLKEILARNFVNYKGCCEKWELMERVTRLYKDQKGLQHL 295

  Fly   645 EKLATDE------------LCKICMDAPIECVFLECGHMATCTSCGKVLNECPICRQYIVRVVRF 697
            ...|.|:            |||||||:||:||.||||||.|||.|||.:|||||||||::|.|..
Human   296 VSGAEDQNGGAVPSGLEENLCKICMDSPIDCVLLECGHMVTCTKCGKRMNECPICRQYVIRAVHV 360

  Fly   698 FRA 700
            ||:
Human   361 FRS 363

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG17019NP_001286365.1 FYVE_CARP 1..42 CDD:277289 16/44 (36%)
zf-C3HC4_3 650..694 CDD:290631 34/56 (61%)
RFFLNP_001017368.1 FYVE_CARP2 44..92 CDD:277309 17/45 (38%)
NYAP_N <149..>232 CDD:292079 38/423 (9%)
zf-C3HC4_3 312..356 CDD:290631 32/44 (73%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C11658760
eggNOG 1 0.900 E1_KOG4275
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 221 1.000 Inparanoid score I3500
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1361306at2759
OrthoFinder 1 1.000 FOG0001869
OrthoInspector 1 1.000 T608437
orthoMCL 1 0.900 OOG5_135289
Panther 1 1.100 LDO PTHR14879
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R4872
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
1211.790

Return to query results.
Submit another query.