DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: vg and Vgll3

Sequence 1:NP_523723.1 Gene:vg FlyBaseID:FBgn0003975 Length:453 Species:Drosophila melanogaster
Sequence 2:NP_001355689.1 Gene:Vgll3 MGIID:1920819 Length:326 Species:Mus musculus

Alignment Length:262 Identity:76/263 (29%)
Similarity:96/263 (37%) Gaps:106/263 (40%)


  Fly   280 QAQYLSASCVVFTNYSGDTASQVDEHFSRALNYNN-------------------KDSKESSSPMS 325
            :.:||::.||:||.:.||..|.|||||||||...|                   :||...||..|
Mouse    83 EMEYLNSRCVLFTYFQGDIGSVVDEHFSRALGQANTLHPESAISKSKMGLTPLWRDSSALSSQRS 147

  Fly   326 NRNFPPSFWNSNYVHPIPAP----TH--HQVSDLYGTAT-------------DTGYATDPWVPHA 371
              |||.|||.|:| .|.|||    .|  .||:..:||.|             .||.|..|....:
Mouse   148 --NFPTSFWTSSY-QPPPAPCLGGVHPDFQVTAPHGTFTTADPNSWPGHGLHQTGPAPPPTASES 209

  Fly   372 AHY-------GSYAHA---------AHAHAAHAHAYHHNMA-------QYGSLL-------RLPQ 406
            .||       .||:|.         .|||..|.|.:||:..       .||.||       |:|.
Mouse   210 WHYPLASQVSPSYSHMHDMYLRHHHPHAHVHHRHHHHHHPTAGSALDPAYGHLLMPSVRAARIPA 274

  Fly   407 QY--------------------ASHGSRLHHDQQTAHALEYSSYPTMAGLEAQVAQVQESSKDLY 451
            ..                    |.||        |...:....:.|  ||     |.|:.||:..
Mouse   275 PQCDITKTDLTTVTTATSAWAGAFHG--------TVDIVPSVGFDT--GL-----QHQDKSKEST 324

  Fly   452 WF 453
            |:
Mouse   325 WY 326

Known Domains:


GeneSequenceDomainRegion External IDIdentity
vgNP_523723.1 Vg_Tdu 282..312 CDD:284876 18/30 (60%)
Vgll3NP_001355689.1 Vg_Tdu 85..115 CDD:336735 18/30 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C33985398
eggNOG 1 0.900 E1_2C0NA
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1146285at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 T615926
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR15950
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R7863
TreeFam 1 0.960
76.930

Return to query results.
Submit another query.