DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: vg and Vgll3

Sequence 1:NP_523723.1 Gene:vg FlyBaseID:FBgn0003975 Length:453 Species:Drosophila melanogaster
Sequence 2:XP_006221112.1 Gene:Vgll3 RGDID:1560030 Length:327 Species:Rattus norvegicus

Alignment Length:261 Identity:76/262 (29%)
Similarity:99/262 (38%) Gaps:103/262 (39%)


  Fly   280 QAQYLSASCVVFTNYSGDTASQVDEHFSRALNYNNKDSKES---------------SSPMSNR-- 327
            :.:||::.||:||.:.||..|.|||||||||...|....||               ||.:|::  
  Rat    83 EMEYLNSRCVLFTYFQGDIGSVVDEHFSRALGQANTLHPESAISKSKMGLTPLWRDSSALSSQRS 147

  Fly   328 NFPPSFWNSNYVHPIPAP----TH--HQVSDLYGTAT-------------DTGYATDPWVPHAAH 373
            |||.|||.|:| .|.|||    .|  .||:..:||.|             .||.|..|....:.|
  Rat   148 NFPTSFWTSSY-QPPPAPCLGGVHPDFQVTAPHGTFTTADPNSWPGHGLHQTGPAPPPTASESWH 211

  Fly   374 Y-------GSYAHA-----------AHAHAAHAHAYHHNMA------QYGSLL-------RLPQQ 407
            |       .||:|.           ||.|..|.|.:||..|      .||.||       |:|..
  Rat   212 YPLASQVSPSYSHMHDMYMRHHHPHAHMHHRHHHHHHHPTAGSALDPAYGHLLMPSVRAARIPAP 276

  Fly   408 Y--------------------ASHGSRLHHDQQTAHALEYSSYPTMAGLEAQVAQVQESSKDLYW 452
            .                    |.||:             ....|:: |.|..: |.|:.||:..|
  Rat   277 QCDITKTDLTTATTATSAWAGAFHGT-------------VDIVPSV-GFETGL-QHQDKSKESTW 326

  Fly   453 F 453
            :
  Rat   327 Y 327

Known Domains:


GeneSequenceDomainRegion External IDIdentity
vgNP_523723.1 Vg_Tdu 282..312 CDD:284876 18/30 (60%)
Vgll3XP_006221112.1 Vg_Tdu 85..115 CDD:284876 18/30 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C33984740
eggNOG 1 0.900 E1_2C0NA
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1146285at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 T618040
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR15950
Phylome 00.000 Not matched by this tool.
TreeFam 1 0.960
65.900

Return to query results.
Submit another query.