DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: vg and VGLL3

Sequence 1:NP_523723.1 Gene:vg FlyBaseID:FBgn0003975 Length:453 Species:Drosophila melanogaster
Sequence 2:NP_057290.2 Gene:VGLL3 HGNCID:24327 Length:326 Species:Homo sapiens

Alignment Length:256 Identity:74/257 (29%)
Similarity:99/257 (39%) Gaps:91/257 (35%)


  Fly   280 QAQYLSASCVVFTNYSGDTASQVDEHFSRALNYN---------NKDS-------KESSSPMSNRN 328
            :.:||::.||:||.:.||..|.|||||||||...         :|..       ::||:..|.||
Human    80 EMEYLNSRCVLFTYFQGDIGSVVDEHFSRALGQAITLHPESAISKSKMGLTPLWRDSSALSSQRN 144

  Fly   329 -FPPSFWNSNYVHPIPAP----TH--HQVSDLYGT--ATDTGYATDPWVPHAAHY---------- 374
             ||.|||.|:| .|.|||    .|  .||:...||  |.|    ..||..|..|.          
Human   145 SFPTSFWTSSY-QPPPAPCLGGVHPDFQVTGPPGTFSAAD----PSPWPGHNLHQTGPAPPPAVS 204

  Fly   375 ------------GSYAHA---------AHAHAAHAHAYHHNM----------AQYGSLLRLPQQY 408
                        .||:|.         .|||..|.|.:||:.          ..||.|| :|   
Human   205 ESWPYPLTSQVSPSYSHMHDVYMRHHHPHAHMHHRHRHHHHHHHPPAGSALDPSYGPLL-MP--- 265

  Fly   409 ASHGSRLHHDQ----QTAHALEYSSYPTMAG-------LEAQVA-----QVQESSKDLYWF 453
            :.|.:|:...|    :|......|:....||       :...|.     |.|:.||:..|:
Human   266 SVHAARIPAPQCDITKTEPTTVTSATSAWAGAFHGTVDIVPSVGFDTGLQHQDKSKESPWY 326

Known Domains:


GeneSequenceDomainRegion External IDIdentity
vgNP_523723.1 Vg_Tdu 282..312 CDD:284876 18/30 (60%)
VGLL3NP_057290.2 Vg_Tdu 82..112 CDD:311481 18/30 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C33985864
eggNOG 1 0.900 E1_2C0NA
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1146285at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 T609101
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR15950
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R7863
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
76.930

Return to query results.
Submit another query.