DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: vg and Vgll2

Sequence 1:NP_523723.1 Gene:vg FlyBaseID:FBgn0003975 Length:453 Species:Drosophila melanogaster
Sequence 2:NP_001101100.1 Gene:Vgll2 RGDID:1311903 Length:323 Species:Rattus norvegicus

Alignment Length:222 Identity:70/223 (31%)
Similarity:98/223 (44%) Gaps:63/223 (28%)


  Fly   199 QQHQHHNESSCSSGPDSPRHAHSHSHPLHGGGGATGGPSSAGGTGSGGGDGGGTGAIPKNLPALE 263
            |:.|..:.|.|||                    |:|..:.:..|.:...:..|:       |..|
  Rat    36 QEAQECSASPCSS--------------------ASGSSTFSNQTPASVKEEEGS-------PEKE 73

  Fly   264 TPMGSGGGGLAGSGQGQAQYLSASCVVFTNYSGDTASQVDEHFSRALNYNNKDSKESSS------ 322
            .|             .:|:|:::.||:||.:.||.:|.|||||||||:..:..:...||      
  Rat    74 RP-------------PEAEYINSRCVLFTYFQGDISSVVDEHFSRALSQPSSYTPSCSSSKTHRS 125

  Fly   323 ----------PMSNRNFPPSFWNSNYVHPIPAPTHHQVSDLYGTATDTGYATDPWVPHAAHYGSY 377
                      ||:.|:||.|||||.|..|:|||..   |.|....::..:||||:.|.|.|...:
  Rat   126 SGPWRAEGTFPMNQRSFPASFWNSAYQAPVPAPLG---SPLAAAHSELPFATDPYTPAALHGHLH 187

  Fly   378 AHAA---HAHAAHAHAYHHNMAQYGSL 401
            ..||   |||..|||. ||..|..|:|
  Rat   188 QGAADWHHAHPHHAHP-HHPYALGGAL 213

Known Domains:


GeneSequenceDomainRegion External IDIdentity
vgNP_523723.1 Vg_Tdu 282..312 CDD:284876 17/30 (57%)
Vgll2NP_001101100.1 Vg_Tdu 79..109 CDD:284876 17/30 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C33987894
eggNOG 1 0.900 E1_2C0NA
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1146285at2759
OrthoFinder 1 1.000 FOG0005929
OrthoInspector 1 1.000 T618040
orthoMCL 1 0.900 OOG5_137725
Panther 1 1.100 LDO PTHR15950
Phylome 00.000 Not matched by this tool.
TreeFam 1 0.960
87.800

Return to query results.
Submit another query.