DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: vg and Vgll2

Sequence 1:NP_523723.1 Gene:vg FlyBaseID:FBgn0003975 Length:453 Species:Drosophila melanogaster
Sequence 2:NP_722481.1 Gene:Vgll2 MGIID:2447460 Length:322 Species:Mus musculus

Alignment Length:226 Identity:73/227 (32%)
Similarity:101/227 (44%) Gaps:61/227 (27%)


  Fly   212 GPDSPRHAHSHSHPLH-----------------GGGGATGGPSSAGGTGSGGGDGGGTGAIPKNL 259
            ||..|..|.::: |.|                 .|..|:|..|.:..|.:...:..|:       
Mouse    12 GPPQPYFAAAYT-PYHQKLAYYSKMQEAQECASPGSSASGSSSFSNPTPASVKEEEGS------- 68

  Fly   260 PALETPMGSGGGGLAGSGQGQAQYLSASCVVFTNYSGDTASQVDEHFSRALNYNNK------DSK 318
            |..|.|             .:|:|:::.||:||.:.||.:|.|||||||||::.:.      .||
Mouse    69 PEKERP-------------PEAEYINSRCVLFTYFQGDISSVVDEHFSRALSHPSSYTPSCTSSK 120

  Fly   319 ----------ESSSPMSNRNFPPSFWNSNYVHPIPAPTHHQVSDLYGTATDTGYATDPWVPHAAH 373
                      |.:.|||.|:||.|||||.|..|:|||..   |.|....::..:||||:.|...|
Mouse   121 AHRSSGPWRAEGTFPMSQRSFPASFWNSAYQAPVPAPLG---SPLAAAHSELPFATDPYSPATLH 182

  Fly   374 YGSYAHAA---HAHAAHAHAYHHNMAQYGSL 401
            ...:..||   |||..|||. ||..|..|:|
Mouse   183 GHLHQGAADWHHAHPHHAHP-HHPYALGGAL 212

Known Domains:


GeneSequenceDomainRegion External IDIdentity
vgNP_523723.1 Vg_Tdu 282..312 CDD:284876 17/30 (57%)
Vgll2NP_722481.1 Vg_Tdu 78..108 CDD:284876 17/30 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C33986480
eggNOG 1 0.900 E1_2C0NA
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0005929
OrthoInspector 1 1.000 T615926
orthoMCL 1 0.900 OOG5_137725
Panther 1 1.100 LDO PTHR15950
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R7863
TreeFam 1 0.960
87.820

Return to query results.
Submit another query.