DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: vg and Vgll1

Sequence 1:NP_523723.1 Gene:vg FlyBaseID:FBgn0003975 Length:453 Species:Drosophila melanogaster
Sequence 2:NP_001300692.1 Gene:Vgll1 MGIID:2655768 Length:307 Species:Mus musculus

Alignment Length:166 Identity:44/167 (26%)
Similarity:63/167 (38%) Gaps:35/167 (21%)


  Fly   285 SASCVVFTNYSGDTASQVDEHFSRALNYNNKDSKESSSPMSNRNFPPSFWNSNYVHPIPAPTHHQ 349
            :|..|:||.:.||..|.|||||||||....:..|.|||..|:     :....|.|:.....|.|.
Mouse    24 NAGSVIFTYFEGDINSMVDEHFSRALRNLKRPHKCSSSSHSD-----NLTLKNGVNKTRTDTSHT 83

  Fly   350 VSDLYGTATDT---GYATDPWV----------PHAAHYGSYAHAAHAHAAHAHAYHHNMAQYGSL 401
            ..:....::.|   |...|..|          |:..|..|:..|..|.:....|...::.:||  
Mouse    84 DRERKVESSQTENSGELKDVPVEEKGTNKSMPPNQRHLSSWTIAQPAASPENGARSSSLDEYG-- 146

  Fly   402 LRLPQQYASHGSRLHHDQQTAHALEYSSYPTMAGLE 437
            |:...|               |:|.....|:...||
Mouse   147 LKAMDQ---------------HSLSMPKTPSALPLE 167

Known Domains:


GeneSequenceDomainRegion External IDIdentity
vgNP_523723.1 Vg_Tdu 282..312 CDD:284876 16/27 (59%)
Vgll1NP_001300692.1 Vg_Tdu 21..51 CDD:284876 16/27 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C33985419
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1146285at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR15950
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
44.000

Return to query results.
Submit another query.