DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: vg and vgll3

Sequence 1:NP_523723.1 Gene:vg FlyBaseID:FBgn0003975 Length:453 Species:Drosophila melanogaster
Sequence 2:XP_021334557.1 Gene:vgll3 ZFINID:ZDB-GENE-130530-600 Length:330 Species:Danio rerio

Alignment Length:375 Identity:94/376 (25%)
Similarity:122/376 (32%) Gaps:123/376 (33%)


  Fly   148 HSLHSSHRTHAHSLAHAHTHPHSHTHTHTHQTKEEDLIVPRSEAEARLVGSQQHQHHNESSCSSG 212
            |..:.:|.....:.|.|..:..::.| |.||                   .||.|....|..|..
Zfish    10 HQSYGAHHYLPSTSAAAAAYKAAYLH-HHHQ-------------------QQQQQQKKFSVFSRM 54

  Fly   213 PDS---PRHAHSHSHPLHGGGGATGGPSSAGGTGSGGGDGGGTGAIPKNLPALETPMGSGGGGLA 274
            .||   |.|...:..|     ||....|.                 |:.||..|...|.......
Zfish    55 QDSEEFPSHCGQNKQP-----GALKSRSE-----------------PELLPEEEQSSGEEDRCKD 97

  Fly   275 GSGQGQAQYLSASCVVFTNYSGDTASQVDEHFSRALNYNNKDS--------------KESSS--- 322
            ......|:||||.|||||.:.||....|||||||||:.|:..|              ||.:|   
Zfish    98 TLQPADAEYLSARCVVFTYFRGDIGDVVDEHFSRALSQNSAFSNDTKASRLNPGGPWKEGNSHSE 162

  Fly   323 -----------------------PMSNRNFPPS---------FWNSNYVHPIPAPT----HHQVS 351
                                   |.|:.:||||         .|:|:.:.|.|:..    |:.: 
Zfish   163 GQTSSLPSSLWGSGYPSQSSPCVPSSHHDFPPSAAFHPADNGIWSSHSLAPPPSALTDSWHYSL- 226

  Fly   352 DLYGTATDTGYATDPWVPHAAHYGSYAHAAHAHAAHAHAYHHNMA-----QYGSLLRLPQQYASH 411
               |..:..||      ||......:.|..|.|....|..||..:     ::..|| ||...||.
Zfish   227 ---GPQSGAGY------PHVHEMYPHMHPRHPHPHAHHVLHHAHSPALDPRFNPLL-LPGVRASC 281

  Fly   412 GSRLHHDQQTAHALEYSSYPT---MAGLEAQV-----AQVQESSKDLYWF 453
            ......|..... ||.||.||   .|.....|     |..|:.:|...||
Zfish   282 SPTSCTDTIKTE-LEPSSIPTPSWPASFHGSVDIYDTALEQDKAKASVWF 330

Known Domains:


GeneSequenceDomainRegion External IDIdentity
vgNP_523723.1 Vg_Tdu 282..312 CDD:284876 20/30 (67%)
vgll3XP_021334557.1 Vg_Tdu 105..135 CDD:311481 20/30 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C33990128
eggNOG 1 0.900 E1_2C0NA
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1146285at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 T596672
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR15950
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R7863
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
76.930

Return to query results.
Submit another query.