DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: vg and si:ch73-52f15.5

Sequence 1:NP_523723.1 Gene:vg FlyBaseID:FBgn0003975 Length:453 Species:Drosophila melanogaster
Sequence 2:XP_001923521.1 Gene:si:ch73-52f15.5 ZFINID:ZDB-GENE-091204-341 Length:214 Species:Danio rerio

Alignment Length:216 Identity:51/217 (24%)
Similarity:79/217 (36%) Gaps:72/217 (33%)


  Fly   290 VFTNYSGDTASQVDEHFSRALN---------YNNKD----------SKESSSPMSNRNFPPSFWN 335
            :||.|.||..:.|||||.||||         ...||          |..||||.:.....||..:
Zfish    19 LFTYYQGDINTAVDEHFFRALNKATIPKDLSIKAKDSSRTPRSDIPSSSSSSPWAMSWSKPSTHS 83

  Fly   336 SNYVHPI-----PAPTHHQV---SDLYGTATDTGYATDPWVPHAAHYGSYA-------HAAHAHA 385
            |:.:.|:     |:|:...:   |.|..:::.:..::....|.|....|.|       :...|..
Zfish    84 SSKLTPLTSMETPSPSQGVIVNPSGLSSSSSSSSSSSSSLWPCAPRQSSSAFELPQILYQQPASG 148

  Fly   386 AHAHAYHHNMAQY----GSLLRLPQQYAS--------------HGSRLHHDQQTAHALEYSSYPT 432
            ..:.:.:.|:.|.    |.::..|...:.              .|||:..|              
Zfish   149 ESSASSYLNLLQMERPAGGIMISPFSKSDTRPEWNSGAAFKDVSGSRISLD-------------- 199

  Fly   433 MAGLEAQVAQVQESSKDLYWF 453
             :||     .|.|.:|||||:
Zfish   200 -SGL-----PVSEINKDLYWY 214

Known Domains:


GeneSequenceDomainRegion External IDIdentity
vgNP_523723.1 Vg_Tdu 282..312 CDD:284876 14/31 (45%)
si:ch73-52f15.5XP_001923521.1 Vg_Tdu <19..41 CDD:284876 14/22 (64%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1146285at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR15950
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.110

Return to query results.
Submit another query.