DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Nmda1 and Tmbim1

Sequence 1:NP_523722.1 Gene:Nmda1 FlyBaseID:FBgn0013305 Length:324 Species:Drosophila melanogaster
Sequence 2:NP_001007714.1 Gene:Tmbim1 RGDID:1359409 Length:309 Species:Rattus norvegicus

Alignment Length:336 Identity:129/337 (38%)
Similarity:187/337 (55%) Gaps:39/337 (12%)


  Fly     1 MSWQSVPQYPQYQDPNQQYNYGGGNPPQGGYGGYPPQGGYPPQGPPQGYPPYAQGGAQPYPQP-Y 64
            ||..:.|  |.|:|.|..|   .|.||.||||        .|...|.|||.|     ..|||| |
  Rat     1 MSNPTAP--PPYEDHNPLY---PGRPPPGGYG--------QPSVLPGGYPAY-----PAYPQPGY 47

  Fly    65 GQGPPPGGYAPQPGFIQPP--PSAGGYGAYDDPESQPKNFSF-----DDQSIRRGFIRKVYLILM 122
            |.   |.|| |||   .||  |....||.....|.:..:.||     ||:.:|..||:|||.|:.
  Rat    48 GH---PAGY-PQP---IPPVHPMPMNYGHDYSEEERAGSDSFGPGEWDDRKVRHTFIQKVYCIIS 105

  Fly   123 GQLIVTFGAVALFVYHEGTKTFARNNMWLFWVALGVMLVTMLSMACCESVRRQTPTNFIFLGLFT 187
            .||::|...:|:|.:.|....:.|:|:.:::|:..|.:||.|.:.||:..||:.|.|.|.|.:||
  Rat   106 VQLLITVAIIAVFTFVEPVSEYVRSNVAVYYVSYAVFIVTYLILVCCQGPRRRFPWNIILLTIFT 170

  Fly   188 AAQSFLMGVSATKYAPKEVLMAVGITAAVCLALTIFALQTKYDFTMMGGILIACMVVFLIFG--- 249
            .|..|:.|..::.|..|.|::|:.|||.|.:::|||..|||.|||...|::....:|..:.|   
  Rat   171 LALGFMTGAISSMYETKAVIIAMIITAVVSISVTIFCFQTKVDFTSCTGLICVLGIVLAVTGAVT 235

  Fly   250 -IVAIFVKGKIITLVYASIGALLFSVYLIYDTQLMMGGEHKYSISPEEYIFAALNLYLDIINIFM 313
             :|..|.....:.:|||.:||:.|:::|.|||||:: |..|::||||:||..||.:|.||:.||.
  Rat   236 SVVLFFEYIYWLHMVYAGLGAICFTLFLAYDTQLVL-GNRKHTISPEDYITGALQIYTDIVYIFT 299

  Fly   314 YILTIIGASRD 324
            ::|.::| :||
  Rat   300 FVLQLVG-NRD 309

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Nmda1NP_523722.1 LFG_like 103..320 CDD:198410 87/226 (38%)
Tmbim1NP_001007714.1 DUF3824 <33..84 CDD:289625 25/63 (40%)
LFG_like 87..306 CDD:198410 85/220 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0670
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000184
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.