DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG12374 and CG8539

Sequence 1:NP_610819.1 Gene:CG12374 FlyBaseID:FBgn0033774 Length:422 Species:Drosophila melanogaster
Sequence 2:NP_001261520.1 Gene:CG8539 FlyBaseID:FBgn0035791 Length:385 Species:Drosophila melanogaster

Alignment Length:326 Identity:88/327 (27%)
Similarity:156/327 (48%) Gaps:39/327 (12%)


  Fly   113 MEWETYHTLDTIYDWIDQECAAH-DFLECKVIGQSYEGRDIKSIRLSK---RSGNKAIFLEGNIH 173
            ::.:.|.:.|.|..::|:...:| :.:..|.:.::||.|.:|...::.   |.|.:.|||:..:|
  Fly    33 LQLDNYLSYDGIMQYLDELALSHSNRVTLKDVARTYENRALKMAIITNGDGRPGKRVIFLDAALH 97

  Fly   174 AMEWISSATVTFLLNQLINSEDPEMQRLSEEYDWIVVPMVNPDGFVYTHEVERLWRKNRRPNGYR 238
            :.||::.|.....:::|: .|..|...|..:|||.::|:.||||:.|:...||.||..|.|||  
  Fly    98 SREWMTPAAALLTIHKLV-VEFAENSDLLTDYDWHIMPLANPDGYEYSRNTERYWRNTRTPNG-- 159

  Fly   239 NESGDCYGIDMNRNFDYHWGGAGWNIDEPCDHWFGGEEPNTEVEIISLQNFVSSFEDGYIRS--- 300
               |:|:|.::||||...|......:.:|||..:.|..|.:|||..::::.:    .|.:.|   
  Fly   160 ---GNCFGTNLNRNFAVDWNVGFPELKDPCDENYAGSSPFSEVEARTVRDIM----HGLVESKRA 217

  Fly   301 --YMAYHAYGQYVLLPYGHSNTEFPPNYEQMKRIAAAFSDAAADVYGS---TFTY----GASGLL 356
              |::.|...:.|..|:.: :|:...|.::...|....:|......|:   |:.|    |..|  
  Fly   218 VMYLSLHTANRSVFYPWVY-DTDPVSNQKEHDEIGRFVADRILQSTGTFIKTWQYAKYAGTFG-- 279

  Fly   357 NYVVSGAAKDWAYGVKKIPFTCTVEL----RDKGTFGFFLPSNQITEVGLEVTAGLKALVNKAAE 417
                 |.:.|:|. :...|.:...|:    ||...:.||.|:..|..:..|...|:||...|..|
  Fly   280 -----GTSMDYAL-LAGFPLSFVFEMSGTGRDHVEYKFFPPARDIRHLAEESWTGIKAFAEKTIE 338

  Fly   418 E 418
            :
  Fly   339 K 339

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG12374NP_610819.1 Propep_M14 34..104 CDD:280416
M14_CP_A-B_like 118..415 CDD:199844 87/317 (27%)
CG8539NP_001261520.1 M14_CP_A-B_like 38..335 CDD:199844 86/316 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C70140279
eggNOG 1 0.900 E1_COG2866
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 66 1.000 Inparanoid score I2432
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D208397at33208
OrthoFinder 1 1.000 FOG0000073
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11705
RoundUp 00.000 Not matched by this tool.
65.990

Return to query results.
Submit another query.