DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG8768 and SULA

Sequence 1:NP_610813.3 Gene:CG8768 FlyBaseID:FBgn0033769 Length:302 Species:Drosophila melanogaster
Sequence 2:NP_001324767.1 Gene:SULA AraportID:AT2G21280 Length:362 Species:Arabidopsis thaliana

Alignment Length:305 Identity:102/306 (33%)
Similarity:155/306 (51%) Gaps:33/306 (11%)


  Fly    12 IGGGTGFIGRNLANHLTKKGYDVTVISR-------------MPG---AKRITWHELEKNGIPGSV 60
            :.|.||||||.|...|....:.:.|::|             .||   |:...|    ||.:.|| 
plant    65 VTGATGFIGRRLVQRLRADNHAIRVLTRSKSKAEQIFPAKDFPGIVIAEESEW----KNCVQGS- 124

  Fly    61 NAVVNATGQNTLDPTRRWTPGFQQNVWNSRINSSKTLAQAIKSAP---QVSSFVNLCGVSHYKPS 122
            .||||..|   |..:.||:|..::.:..|||..:..:...|.::|   :.:..|:...|.:|..|
plant   125 TAVVNLAG---LPISTRWSPEIKKEIKGSRIRVTSKVVDLINNSPAEARPTVLVSATAVGYYGTS 186

  Fly   123 ESKVYTEEDQVQGFDYMSRLCLAWEEAAHTGSEQDCKTTILRCGAVVGHGGGMVQSMWLP-FKFG 186
            |:.|: :|:...|.||::.:|..||..| ..:.:|.:..::|.|.|:|..||.: :|.:| |:..
plant   187 ETGVF-DENSPSGKDYLAEVCREWEGTA-LKANKDVRVALIRIGVVLGKDGGAL-AMMIPFFQMF 248

  Fly   187 VGGPLGNGNQIMPWIHLHDLCSLIQYIIEKP-VPGVVNAVAPEITSNLEFSKAFAKALHRPCIFG 250
            .|||||:|.|...|||:.||.:||...:..| ..||:|..||......|..:.....|.||....
plant   249 AGGPLGSGQQWFSWIHVDDLVNLIYEALTNPSYKGVINGTAPNPVRLGEMCQQLGSVLSRPSWLP 313

  Fly   251 VPEFVVQAIFGPERAALVLSGAKVKPQKALSSGFKFQYPSVKEAV 295
            ||:|.::|:.| |.|.:||.|.||.|.:|...||:|:|..||:|:
plant   314 VPDFALKALLG-EGATVVLEGQKVLPVRAKELGFEFKYKYVKDAL 357

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG8768NP_610813.3 SDR_a8 9..299 CDD:187553 102/306 (33%)
yfcH 10..295 CDD:273800 102/304 (34%)
SULANP_001324767.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 1 1.000 H69295
Inparanoid 1 1.050 146 1.000 Inparanoid score I1701
OMA 1 1.010
OrthoDB 1 1.010 D1498565at2759
OrthoInspector 1 1.000 T124829
orthoMCL 1 0.900 OOG5_130575
Panther 1 1.100 LDO PTHR11092
Phylome 1 0.910 0.667 Consistency score
98.980

Return to query results.
Submit another query.