DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Nup188 and NUP188

Sequence 1:NP_001246283.1 Gene:Nup188 FlyBaseID:FBgn0033766 Length:1866 Species:Drosophila melanogaster
Sequence 2:NP_013604.1 Gene:NUP188 SGDID:S000004571 Length:1655 Species:Saccharomyces cerevisiae

Alignment Length:1996 Identity:377/1997 (19%)
Similarity:683/1997 (34%) Gaps:632/1997 (32%)


  Fly   119 AKLHEDIRHYYSLERMVVLKIVKNLIVFHQ-VPNHPYHREYRAVVEK-ITIPRLRDSYLDQLESL 181
            ||....||.:....:   ..::::|....| |.:...|.:.|:.:.. :.|....|.:..|.|.|
Yeast    34 AKQLAQIRQFLKANK---TNLIESLNTIRQNVTSSGDHNKLRSTIANLLQINVDNDPFFAQSEDL 95

  Fly   182 ICEVPPRKLMAGECFHSAERLVAWSERNAREINEVLHILLVLAEHLPMGLEQIKRIFAACKQHSF 246
                          .|:.|..:  |||::|     |||:..|..:..:.||              
Yeast    96 --------------SHAVEFFM--SERSSR-----LHIVYSLLVNPDIDLE-------------- 125

  Fly   247 GKMQSYLDDSQPYHQEIIRSLSYSELMLVLKCLDFEKPEKHSDLIEKLIEDLQVDIASMYHRPEH 311
              ..|::|:.:                       |....|...:|..:|::..:..||.      
Yeast   126 --TYSFIDNDR-----------------------FNVVGKLISIISSVIQNYDIITASS------ 159

  Fly   312 GPLLLAWMLLRLRGTNDADDASSLLRCRQLGKRAVDLKCFVQ----LHLIARHSMYADDSMLSRI 372
                ||      ...|:..|..:::...|| |:..|||..:|    |:|:          :|:..
Yeast   160 ----LA------HDYNNDQDMFTIVSLVQL-KKFSDLKFILQILQILNLM----------ILNTK 203

  Fly   373 VRRTIYNQVGYLCDLFDGDGSCARYEGIYELLCELVSWPHLAKDFCSREDDGPCSLYKTLLENFP 437
            |...|.|| .:|           :|:..:...|..::....:.|..|.:      |||  .:||.
Yeast   204 VPVDIVNQ-WFL-----------QYQNQFVEFCRNINSTDKSIDTSSLQ------LYK--FQNFQ 248

  Fly   438 LELTHLSKLALSLTKAGQGNYVKSQLEALPILALRYDESQHKLRE---VDTNEFELLASVQPFQQ 499
             :|::||:..:|...:      ...:..:.||.|....:|..::.   :||..|:.:.|.     
Yeast   249 -DLSYLSETLISRISS------LFTITTILILGLNTSIAQFDIQSPLYMDTETFDTVNSA----- 301

  Fly   500 IDFTIPAG-TSCTAIQHPSGCFMHF--RFPVNY---------FD-------ALHHEINCLLRETG 545
            ::..:... .:...|.||   .:|:  .|.:.|         ||       ||..|.:.:|::..
Yeast   302 LENDVATNIVNEDPIFHP---MIHYSWSFILYYRRALQSSESFDDSDITKFALFAESHDVLQKLN 363

  Fly   546 HLHGDFESSERIRN--VEAGLRFLESAVKLSQSISGISAEMVH--PTEMCVDLL--HTFKSVQYP 604
            .| .:..|.:.:..  :...|.|..:.:.::.|.|.:.|:::.  |.:...:.|  .||:..   
Yeast   364 TL-SEILSFDPVYTTVITVFLEFSLNFIPITASTSRVFAKIISKAPEQFIENFLTNDTFEKK--- 424

  Fly   605 PVGLLSSCLNVCTALLPLVDEEIFSRISNLHILPTVSPGSHYDFKMYANANGVGFESRFLGSVID 669
                    |::..|.|||::|.:...| ||.::.|          .:||     ||.:.:.|...
Yeast   425 --------LSIIKAKLPLLNESLIPLI-NLALIDT----------EFAN-----FELKDICSFAV 465

  Fly   670 NVEKKRERYEFLLSYIGFLRAYSNLKRNRQIQMEIPGLIFLLKD--VFPHLHTWHFSSQVERNKI 732
            ......:     |.|.......:|...:..|  .:|.||.|..|  |.|.|...:.:.       
Yeast   466 TKSSLND-----LDYDLIADTITNSSSSSDI--IVPDLIELKSDLLVAPPLENENSNC------- 516

  Fly   733 YFEILSFICDILDLFNTAKESNCKQRELLVKVCVYSLLNLENG----------LILLRFVG---V 784
               :||..........|.|:...:|::             :||          :.|.:|.|   |
Yeast   517 ---LLSIPKSTKGKILTIKQQQQQQQQ-------------QNGQQPPTTSNLIIFLYKFNGWSLV 565

  Fly   785 G-------NAYVQYTMELETNWMQQQPHGLMMLVRLSMRILMQLLRLKEEVYGNSETLSPLEALI 842
            |       ::|::...:|:     ...|.||:.:   ::::..::..|..:..:||.||.|...:
Yeast   566 GRILQNLLHSYMEKGTQLD-----DLQHELMISI---IKLVTNVVDPKTSIEKSSEILSYLSNSL 622

  Fly   843 YTQPK-------------------QRDTLRIIPTVCSYMSNIFDRWLPILSCRLLKRIALQ---- 884
            .|...                   ||.....|...|.:|:.:...:|.::|..|.|...|.    
Yeast   623 DTSASTINGASIIQVIFEIFEISLQRKDYTSIVQCCEFMTMLTPNYLHLVSSYLNKSDLLDKYGK 687

  Fly   885 ---FNMSLLACLDMEADQIRLTF-MQKLPDELESDSI--------KIAILELVDACIAKQPGVTE 937
               .|| :|..:::.......|. :.||......:|:        |.:.:::::..|.....:.|
Yeast   688 TGLSNM-ILGSVELSTGDYTFTIQLLKLTKVFIRESLSLKNIHISKRSKIDIINKLILHAIHIFE 751

  Fly   938 AFF--KVNYALDKRSRSF------------------FSKD--CVPNIGESIVTYMRDFLDALQVD 980
            :::  |.|..|.|...:|                  ..||  .:.:....::......:|::.:.
Yeast   752 SYYNWKYNNFLQKFEIAFHLTLIFYDVLHDVFTINPHQKDQLIISSSANKLLQLFLTPMDSIDLA 816

  Fly   981 PLTIQQALPAKIMTIFHSMWKHNLQMLVDDL-------VKDKQFWKKLCSPLFS------ELQP- 1031
            |.|:...|.:.:.|        ..::|.|.:       |.:..|  |||:.|.:      :|:| 
Yeast   817 PNTLTNILISPLNT--------TTKILGDKILGNLYSKVMNNSF--KLCTLLIAIRGSNRDLKPS 871

  Fly  1032 NLRIYTQLLNIIS---IEVYTGNGN---NAALLDVMNKFFEQKNFGPWLNYVFNMPKVPAVKNLS 1090
            ||.   :||.|.|   ::|||....   ...::::::...|    .||                 
Yeast   872 NLE---KLLFINSSKLVDVYTLPSYVHFKVQIIELLSYLVE----APW----------------- 912

  Fly  1091 SSDHLPDWICCLQAFKDLIVILLKKQPKFVTIPESQFKLMAQKCLVVLVDRSNYLEDMRPFIILA 1155
             :|..|..:..|...|.:  ..||:                     ||.|.|:.::|..   :|.
Yeast   913 -NDDYPFLLSFLGEAKSM--AFLKE---------------------VLSDLSSPVQDWN---LLR 950

  Fly  1156 ELYVFILLEFKHAYTDSLEEEQTLMDLLLQLMNRICA---CYEDQHVRAKEACLAIVTK------ 1211
            .||:|        :|..||.:|..:.:|. |..:..:   ..::..:..|.:.|.::.|      
Yeast   951 SLYIF--------FTTLLESKQDGLSILF-LTGQFASNKKINDESSIDKKSSILTVLQKNSLLLD 1006

  Fly  1212 -------CTHLYT-----------DLLIRDSSIALRFLNSVVGIICSE---LQHMEN-----SVS 1250
                   |..|.|           .:.|:|.    :|:||::..:...   .|..||     :||
Yeast  1007 STPEEVSCKLLETITYVLNTWTNSKIFIKDP----KFVNSLLAKLKDSKKLFQKKENLTRDETVS 1067

  Fly  1251 LEKSQGL-------------NNSDSSDSKTSTNSLIL-CLN---LLKAVATIFHNDG-------- 1290
            |.|...|             |::||       ||.|| .||   |.:.|...|..||        
Yeast  1068 LIKKYKLISRIVEIFALCIYNSTDS-------NSEILNFLNQEDLFELVHHFFQIDGFNKTFHDE 1125

  Fly  1291 -----PGNWDLPFVSVRLFQRLVRCVSRTLPL--------FSKQVLSVQLLDVLIVFAKGHCSVE 1342
                 ...|  |.:.::.||:        :||        |.   ..:.|||:::          
Yeast  1126 LNLKFKEKW--PSLELQSFQK--------IPLSRINENENFG---YDIPLLDIVL---------- 1167

  Fly  1343 FLHCDVGEYLWLKLLPPRELLQSKHEFTKTTA----ADAEGWTVEQWWPVYARGIELVTIIYEKH 1403
                 ..:..|.:  |.:.....|.|.|..:.    .:.|..|.:.|      |..:.|.:  |.
Yeast  1168 -----KADRSWNE--PSKSQTNFKEEITDASLNLQYVNYEISTAKAW------GALITTFV--KR 1217

  Fly  1404 KKCFLEDAF-----QFVGIHAVFLEDALLLSKQSLEPSAMYLIKAAVNLVASLTEHHKEWKQDSD 1463
            ....|.|.|     .|:.::..|..|..:.::..||     .|:.:..::.|.....|..|::..
Yeast  1218 STVPLNDGFVDLVEHFLKLNIDFGSDKQMFTQIYLE-----RIELSFYILYSFKLSGKLLKEEKI 1277

  Fly  1464 LSLANLMRAV--QSLLCHTSSLFHQQKN--LKCLLAGRRSQLEILRSTEALI--VDDELISACND 1522
            :.|.|.:..:  ...:....::....||  .:.||......||::.|.:..|  :.|:|:    :
Yeast  1278 IELMNKIFTIFKSGEIDFIKNIGKSLKNNFYRPLLRSVLVLLELVSSGDRFIELISDQLL----E 1338

  Fly  1523 LTDIIISCVKALLRFSPDLMELLC----CSA-------------YEPSKHSILLDVKFGAPKLNE 1570
            ..:::.|....|:     |.|:||    ||.             .|.:...:||.:.. ..|:..
Yeast  1339 FFELVFSKGVYLI-----LSEILCQINKCSTRGLSTDHTTQIVNLEDNTQDLLLLLSL-FKKITN 1397

  Fly  1571 ENLTLTFGIVLNLVNIYVKALNMQNHGFSEVPLNSLPNVEHSGDNDDPEVCVGNQTNRTFSKPLS 1635
            .|.:..|.::|        |.::...|..:|.||...:......||:|   :..|...||...|.
Yeast  1398 VNPSKNFNVIL--------ASSLNEVGTLKVILNLYSSAHLIRINDEP---ILGQITLTFISELC 1451

  Fly  1636 NVSISTGTCPASELLSNMDGQLCLLALEHLLMLVASQAICIIRSPNLETLWKQIVRRDISNELLI 1700
            ::.      |.:..|.| .|...:|....|.:.:....|....||.|..:|...:   :|..||:
Yeast  1452 SIE------PIAAKLIN-SGLYSVLLESPLSVAIQQGDIKPEFSPRLHNIWSNGL---LSIVLLL 1506

  Fly  1701 FNEFVRRKVI------LDY--KENRSP---WLRRKHGLCKLKCVDPVRSSSSSSRSSEIVRRSNT 1754
            .::| ..||:      :.|  |:.:|.   |...|..:          |||....::::|.....
Yeast  1507 LSQF-GIKVLPETCLFVSYFGKQIKSTIYNWGDNKLAV----------SSSLIKETNQLVLLQKM 1560

  Fly  1755 NNELRVNVVRRLHLQ------QQQRTPPPQNFDMSSDLSPIAAAQGAAMTTSLDGRKRLYPAQQA 1813
            .|.|.   .:.|.:|      ||:........|...|...::||....:|.......|:.|....
Yeast  1561 LNLLN---YQELFIQPKNSDDQQEAVELVIGLDSEHDKKRLSAALSKFLTHPKYLNSRIIPTTLE 1622

  Fly  1814 GDAFLEDELAAIELQYFPPPTEPGYCELSQVQVVEEDYLQLMSALF 1859
            ....||||.:.:|.                |:.:..|...|..:||
Yeast  1623 EQQQLEDESSRLEF----------------VKGISRDIKALQDSLF 1652

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Nup188NP_001246283.1 Nup188 31..943 CDD:287461 169/917 (18%)
NUP188NP_013604.1 Nup188 39..976 CDD:287461 221/1199 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR31431
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.100

Return to query results.
Submit another query.