DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Nup188 and AT4G38760

Sequence 1:NP_001246283.1 Gene:Nup188 FlyBaseID:FBgn0033766 Length:1866 Species:Drosophila melanogaster
Sequence 2:NP_195587.5 Gene:AT4G38760 AraportID:AT4G38760 Length:1965 Species:Arabidopsis thaliana

Alignment Length:2252 Identity:417/2253 (19%)
Similarity:758/2253 (34%) Gaps:773/2253 (34%)


  Fly    27 PQDTVREELMN----------VASELQ------AGVL-QFKPKNASSLEL--GTLLKEKKQE--- 69
            |.|::..:|.|          :|.:|:      .|.| .|||.:..|.|.  ..|:|.|:.:   
plant    15 PFDSLLTDLENASLSDDLPQPIAKKLEENHAWFVGTLSMFKPPSEKSKEALNSDLVKIKEHQLVI 79

  Fly    70 --KLLPFTERLQDLLDLESAQCWEILCYYLTQEYRGSASLLTQLISTETNMAKLHEDIRHYYSLE 132
              :|.....|:...|:|:..|.:.::...:.|||..:.|:..:|.....:|..|.      |.::
plant    80 KPQLKDKALRISSHLNLDEIQSYILVERSMEQEYGTTDSVAQELTQEFIDMILLQ------YYIQ 138

  Fly   133 RMVVLKIVKNLIVFHQVPNHPYH--REYRAVVEKITIPRLRDSYLDQLESLICEVPPRKLMAGEC 195
            |..:||..|.:::      |..:  ||..::.|:..  :|....|::.:|.:.|.     :...|
plant   139 RQCLLKCTKRILI------HALYAPREESSIKEEAV--KLISDGLERRQSSVLED-----LLSSC 190

  Fly   196 F---HSAERLVAWSERNAREINEVLHILLVLAEHLPMGLEQIKRIFAACKQHSFGKMQSYLDDSQ 257
            |   ........|:|....|.|.:|.||.::          ....:.:|....:.|:.|:     
plant   191 FPKNMDVNLFTLWAEETLIEDNLILDILFLI----------YNESYCSCNGERWRKLCSF----- 240

  Fly   258 PYHQEIIRSLSYSE------------------LMLVLKCLDFEK---------PEKHSDLIEKLI 295
             |...:..|.::|:                  ||::::.||.|.         |.:....:..::
plant   241 -YKGILSGSYNFSKLAVSVEAQHSACRVQIQLLMILIETLDMENLLQMVHDGVPFRSGTCVFSIV 304

  Fly   296 EDLQVD--IASMYHRP--EHGPLLLAW-----MLLRLRG---------------TNDADDASSL- 335
            :..::|  |:|:....  |.|||:|||     ::..|.|               .:.|.:|:|| 
plant   305 DVQEMDATISSLNTSEVNEAGPLVLAWAVFLCLISSLPGKEESPFLMDIDHVSYVHQAFEAASLS 369

  Fly   336 -----LRCRQL--------GKRAVDLKCFVQLHLIARH-SMYADDSMLSRI--VRRTIYNQVGYL 384
                 |:...|        |.|:| ::.|:...:.:.. ::..:|..|..|  :...:|.....|
plant   370 YFLEILQSNLLNDFDGPISGHRSV-VRTFISAFIASYEINLQLEDGTLELILDILSKVYQGEESL 433

  Fly   385 CDLF-------DGDGSCARYE----------GIYELLCELV--SWP-HLAKDFCSRE-------- 421
            |..|       ||...|..::          ....||..|.  ||| ....:|..:.        
plant   434 CCQFWDRKSFVDGPIRCLLFDLESEFPFRSAEFIRLLSSLSEGSWPAECVYNFLDKSVGVSTLFD 498

  Fly   422 --DDGPCSLYKTLLE-NFPLELTHLSKLALSLTKAGQGNYVKSQ----------LEALPILALRY 473
              .|.|......|:| :.||.:..|..|.:.....|:...|.|:          |..:.:|.:|.
plant   499 ITSDSPADDASQLVETSRPLHIPGLEGLVIPSNTRGRILRVISENTVLVRWEYSLSGIIVLIIRL 563

  Fly   474 DESQHKLREVDTNE----FELLASVQPFQQIDFTIPAGTSCTAIQHPSGCFMHFRFPVNYFDALH 534
               .:||...:..|    .|||..:..|.:        ..|.::.:.|    ||.:.        
plant   564 ---ANKLYIGNNREAFVTLELLRRMVTFNK--------AVCFSLLNIS----HFFYV-------- 605

  Fly   535 HEINCLLRETGHLHGDFESSERIRNVEAGLRFLESAVKLSQSISGISAEMVHPTEMCVDLLHTFK 599
                    :..:::|..||..|:.::      :.::|:.....||.:|.|.    |.:|:|  .|
plant   606 --------QESYVNGKMESDVRVVDI------ICNSVRSLTFDSGGAAVMA----MAIDIL--AK 650

  Fly   600 SVQYPPVGLLSSCLNVCTALLPLVDEEIFSRISNLHILPTVS--PGSHYDFKMYANANGVGFESR 662
            .::..|           :::.|:|.:      ||:..:.:.|  |.|.|:..:   :.......:
plant   651 LLRCSP-----------SSVAPMVLK------SNIFDMTSCSDVPDSGYNISL---SGSWSLSGK 695

  Fly   663 FLGSVIDNVEKKRERYEFLLSYIGFLRAYSNLKRNRQIQMEIPGL---------IFLLKDVFPHL 718
            ....::.:.||.......::|.:.|           .:|:...||         :|.|:.:....
plant   696 LAKMILIDCEKNDTSCPLVISVLEF-----------TMQLVEGGLENDVVFALVVFSLQYILASH 749

  Fly   719 HTWHFSSQVERNKIYFEILSFI--CDILDLFNTAKESNCKQRELLVKV-----CVYSLL------ 770
            ..|.::....|.|:..:::..:  |.....|:|      |.|::|:.:     .|:|.|      
plant   750 EYWKYNHGNMRWKVTLKVIELMKTCLRFSKFST------KLRDVLLDILLNDASVHSALFRIICT 808

  Fly   771 ---NLENGLILLRFVGVGNAYVQYTMELETNWMQQQPHGLMMLVRLSMRILMQLLRLKEEVYGNS 832
               |||| |...||:        ...|:| .|            :|::..::.:|.:....:..|
plant   809 TTQNLEN-LCSSRFI--------EPAEIE-GW------------QLAIVSVLDVLNVILSQFSES 851

  Fly   833 ETLSPL----EALIYTQPKQRDTLRIIPTVCSYMSNIFDRWLPILSCRLLKR---IALQFNMSLL 890
             |.|.|    :|::.:..|....:..|.::.||..|   ..:.:.:.::|.:   :|....:.::
plant   852 -THSGLPVFHQAMLSSTTKPISVVAAITSLISYFRN---PTIQVCAAQVLSKLFALAESSQLYII 912

  Fly   891 ACLDMEADQIRLTFMQKLPDEL------ESDSIKIAILELVDACIAKQPGVTEAFFKVNYALD-- 947
            :......|..::|.::....::      :::.:.:|.|:|:......||.:..|.|..:...|  
plant   913 SNAGFGLDNKQITDLRNSVTQIVLDLSGQNEHLVVATLKLLTVAARFQPALLVAIFDSDEDSDSS 977

  Fly   948 --KRSRSFFSKD--------CVPNIGESIVTYMR---DFLD-----------------------A 976
              |:||    ||        |...:..:|:.|:.   ||:|                       |
plant   978 NVKQSR----KDASSIPDWACKSRLLHTILQYVERATDFVDRHTDILLGLLDFLKTLWQEAGQYA 1038

  Fly   977 LQVDPL------------TIQQALPAKIMT--------IFHSMWKHNLQMLVDDLVKDKQF-WKK 1020
            ..::|.            .|.||...|..|        |...:.|:..|..|.:::....| :||
plant  1039 NMLEPFKASKKLWQEFSDIISQASKIKDSTVGSLGKEEISKLLVKYQCQASVLEIMACNMFLYKK 1103

  Fly  1021 LCSPLFSE----------------LQPNLRIYT---------------QLLNIISIEVYTGNGNN 1054
            |   ||:|                :.|....:|               .:|:.|...|.:.:|.:
plant  1104 L---LFAESLKKPCVETKKTASNGVSPPKLTWTADSDPKDIFSKWCDISVLDGIIQSVSSLDGES 1165

  Fly  1055 --------AALLDVMNKFFEQKNFGPWLNYVFNMPKVPAVKNLSSSDHLPDWICCLQAFKDLIVI 1111
                    ||:|.:::...:.:..|..   ..:|..|..:|.:|.:      :|...||.:|:..
plant  1166 EINFQAKVAAVLLIVHLIVKLETSGAG---ALSMVLVEKIKLISET------LCAQPAFSELLAQ 1221

  Fly  1112 LLK--------KQPKFVT--------------IPESQFKLMAQ---------------------- 1132
            ..|        ..|...:              ||...||.:.|                      
plant  1222 YSKLGYSGGKELMPMIFSDLYCHLQGKLEGRDIPTGPFKELFQFLVETSFWEKYKQKTNKDVNMA 1286

  Fly  1133 --KCL-----------VVLVDRS-------------NYLEDMRPFIILAELYVFILLEFKHA--- 1168
              .||           :.:.|.|             ||::.....::|:...:.:|    ||   
plant  1287 LGDCLFDTQQIQTELGIDIWDFSEWKTSKTTAEEMLNYMQRANSMVLLSTSQLSVL----HALIS 1347

  Fly  1169 ----YTDSLEEEQTLMD------LLLQLMNRICACYEDQHVRAKEAC-----LAIVTKCTHLYTD 1218
                |.|:..||....:      :.|..::::|          ::.|     ||.:.....:..|
plant  1348 VLILYEDNSLEESAAAERKIPSRVTLLSIDKVC----------RKFCTTVDSLASLWDAPKIVFD 1402

  Fly  1219 LLIRDSSIALRFLNSV---------------VG---IICSELQHMENSVSLEKS----------- 1254
            :|...:.:..|.|.|.               ||   .|...|:| .|:: |:|:           
plant  1403 ILTAQADLLSRLLKSAKKNLSLSVCALVLRNVGPGLKILGSLRH-SNAI-LKKTINLLLEVLLLV 1465

  Fly  1255 --QGLNNSDSS------------DSKTSTNSLI--------------LCLNLLKAVATIFHNDGP 1291
              .|.:||:||            :...:|..|:              |||..:..:...|..  |
plant  1466 VGFGSDNSNSSGMGHMVLAKDFAEISDATIGLLPLLCNFMGNPEYLTLCLTTVDLILRNFLT--P 1528

  Fly  1292 GNWDLPFVSVRLFQRLVRCVSRTLPLFSKQVLSVQ-LLDVLIVFAKGHCSVEFLHCDVGEYLWLK 1355
            ..| .|.:..:|  ||...:.:...  .|...||. :|...:..|:.|...:.| .:.|.:..| 
plant  1529 ETW-FPIIQSQL--RLQHVILQLQD--KKSTTSVSAILKFFLTIAQVHGGAQML-LNSGFFSTL- 1586

  Fly  1356 LLPPRELLQSKHEFTKTTAADAEGWTV----EQWWPVYARGIELVT-IIYEKHKKCFLEDAFQFV 1415
                |.||....:...|..:|.|..::    |:...::..|:.:|| :::.........|..:.|
plant  1587 ----RALLMEFPDGMSTLVSDNEKGSLLEKTEKTQHIWGIGLAVVTAMVHSLGSVSAGADIVESV 1647

  Fly  1416 GIHAVFLEDALLLSKQSLEPSAMYLIKAAVNLVASLTEHHKEWKQDSDLSLANLMRAVQSLLCHT 1480
             |...|||...::|.....|......:..|.|.:..|     |     .|||.|.....:||   
plant  1648 -ISYFFLEKGYMISYYLAAPDFPSDDRDKVRLRSQRT-----W-----TSLAYLRVTEHTLL--- 1698

  Fly  1481 SSLFHQQKNLKCLLAGR-RSQLEILRSTEALIVDDELISACNDLTDIIISCVKALLRFSPDLMEL 1544
                     |.|.||.. ||.::|::.     :|..|......|...|....:.|......:..|
plant  1699 ---------LLCALASHWRSWVKIMKD-----MDSPLREMTIHLLAFISKGAQRLRESQSHISHL 1749

  Fly  1545 LCCSAYEPSKHSILLDVKFGAPKLNEENLTLTFGIVLNLVNIYVKALNMQNHGFSEVPLNSLPNV 1609
            ||                  .|...||                          |......|..|.
plant  1750 LC------------------PPVAKEE--------------------------FDSCKRPSFINT 1770

  Fly  1610 EHSGDNDDPEVCVGNQTNRTFSKP-LSNVSIST------------GTCPASELLSNMDGQLCLLA 1661
            :|...:..|.||||        || ::.|||||            |:.|.|:...::..|:..:|
plant  1771 KHGWFSLAPLVCVG--------KPKITAVSISTALVVRGDTTEHPGSVPQSQFSDSVAIQIYRVA 1827

  Fly  1662 LEHLLMLVASQAICIIRSPNLETLWKQIVRRDISNELLIFNEFVRRKVILDYKENRSPWLRRKHG 1726
             ..||..:..||..::      |..:::...||::    |.|....:::              ||
plant  1828 -SLLLKFLCLQAEGVV------TRAEEVGYVDIAH----FPELPEPEIL--------------HG 1867

  Fly  1727 LCKLKCVDPVRSSSSSSRSSEI-----------VRRSNTNNELRVNVVR--RLHLQQQQRTPPP- 1777
            | :.:....|.....:.:|.||           ::.:..:..|.:.||:  |:|         | 
plant  1868 L-QDQATAIVAELCDNYKSKEIPDEVKKLCLMLIQTTEMSLYLELCVVQVCRIH---------PV 1922

  Fly  1778 ----QNFDMSSDLSPI--AAAQGAAMTTSLDGRKR----LYP 1809
                .||  |.||..:  ||.....:..|:|..|:    |||
plant  1923 FGRVDNF--SKDLKKLVKAAEVHTYLEPSIDSLKKIAAFLYP 1962

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Nup188NP_001246283.1 Nup188 31..943 CDD:287461 200/1094 (18%)
AT4G38760NP_195587.5 Nup188 36..>775 CDD:287461 157/849 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR31431
Phylome 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.