DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Nup188 and nup188

Sequence 1:NP_001246283.1 Gene:Nup188 FlyBaseID:FBgn0033766 Length:1866 Species:Drosophila melanogaster
Sequence 2:XP_001923018.1 Gene:nup188 ZFINID:ZDB-GENE-030131-7184 Length:1732 Species:Danio rerio

Alignment Length:1844 Identity:422/1845 (23%)
Similarity:746/1845 (40%) Gaps:340/1845 (18%)


  Fly    13 KRLWPMVSGIHYETPQDTVREELMNVASELQAGVLQFKPKNASSLELGTLLKEKKQ--EKLLPFT 75
            :.||.::.|.........:.:||......|..|:..:|..:.|:.:   .||..|.  :.|..|.
Zfish    12 RELWSILLGRSALREPAQIEDELNRNWERLLQGLSFYKQPSTSAAD---KLKADKDTPQALKDFG 73

  Fly    76 ERLQDLLDLESAQCWEILCYYLTQEYRGSASLLTQLISTETNMAKLHEDIRHYYSLERMVVLKIV 140
            .|:..||.|:..|..::|..||.::|||:.:.|..::..|.....|...|..||..||:.||:.|
Zfish    74 LRISKLLGLDEQQSVQVLQCYLQEDYRGTRNTLKAVLQDERQSQALLLKIADYYYEERLCVLRCV 138

  Fly   141 KNLIVFHQVPNHPYHREYRAVVEKITIPRLRDSYLDQLESLICEVPPRKLMAGECFHSAERLVA- 204
            .:|:.:.|...|||..||...|.|:. ..|..:|..|.|:|.....|.....|...  .||.|: 
Zfish   139 LHLLTYFQDERHPYRAEYSNCVSKLE-KDLVSNYRQQFETLSKSEAPTWETHGNLM--TERQVSR 200

  Fly   205 WSERNARE---INEVLHILLVLAEHLPMGLEQIKRIFAACKQHSFGKMQS---YLDDSQPYHQEI 263
            |..:..:|   :.|:|.:.....|..|..|....|:|   |:..||:.|:   .:|.|.   ..:
Zfish   201 WFVQCLKEQALLLEILFLYYAYFEMSPNDLCTFTRLF---KEQGFGQRQTNRHLVDKSM---DTL 259

  Fly   264 IRSLSY-SELMLV--------LKCLDFEKPEKH-----SDLIEKLIEDLQV--DIASMYHRPEHG 312
            :..:.| |.||||        .||...::.|:|     .|:.:::.:.|..  ||      |.||
Zfish   260 VERIGYFSSLMLVEGMDIDFLHKCALEDRTEQHQFYDQQDVCKEMDQMLLTFGDI------PHHG 318

  Fly   313 PLLLAWMLLRLRGTNDADDASSLLRCRQLGKRAVDLKCFVQLHLIARHSMYADDSMLSRIVRRTI 377
            |:||||:|  ||.|...::.||::  |:||...:.|..|..|..:.:....|.::......|..|
Zfish   319 PVLLAWVL--LRHTLRPEEVSSVI--RRLGNTTLQLGVFQYLTNMLQALGSAGNNCTVSTARMCI 379

  Fly   378 YNQVGYLCDLFDGDGSCARYEGIYELLCELVSWPHLAKDFC-SREDDGPCSLYKTLLENFPLELT 441
            |..:.::...|:.| :....:.:....||::..|.||:.|. |:.:.|...:..:.:..||.:..
Zfish   380 YGLLSFVITSFEED-TLGSQQHLINAACEVLGAPSLAELFWESKPNMGLGVILDSAVGVFPYKTG 443

  Fly   442 HLSKLALS-LTKAGQGNYVKSQLEALPILALRYDESQHKLREVDTNEFELLASVQPFQQIDFTIP 505
            .|.:|..: |:.......|.:.|:.:......|   :|:..:|.:.|...|...|..:.:   .|
Zfish   444 PLLQLLTALLSDKSTAKKVYTFLDKMSFYTEAY---KHRPNDVISREDGTLWRRQTHKLL---YP 502

  Fly   506 AGTSCTAIQHPSGCF-----------------MHFRFPVNYFDALHHEINCLLRETGHLHGDFES 553
            .|...|.::.|.|||                 :.:.:..:.:.....||..||    |:....:.
Zfish   503 LGVGQTNLRMPQGCFGQVCEGKQLSVGEQGFLVRWEYSYSSWTLFTCEIEMLL----HVVSTADV 563

  Fly   554 SERIRNVEAGLRFLESAVKLSQSISGISAEMVHPTEMCVDLLHTFKSVQYPPVGLLSSCLNVCTA 618
            ....:.|:..|..:...:....::|..   ::..|.....||....|:..|||.:::||:|...|
Zfish   564 LVHCQRVKPILDLVHKIISTDWTVSDC---LLPLTSRIYMLLQRLTSIINPPVDVITSCVNCLIA 625

  Fly   619 LLPLVDEEIFSRISNLHILPTVS-PGSHYDFKMYANANGVGFESRFLGSVIDNVEKKRERYEFLL 682
            |......:::|.:.:...||..| |.::    |....:..|.::...|:::..:|:.|..|... 
Zfish   626 LAARQPAKVWSSLHHTGFLPFASTPLTN----MTQAISAEGMKAGNYGNLLVLIEQPRGEYSVT- 685

  Fly   683 SYIGFLRAYSNLKRNR----QIQMEIPGLIFLLKDVFPHLHTWHFSSQVERNKIYFEILSFICDI 743
              |.|||..:.|.:.:    |.:..||.::.:||::.|..|.|.:::...|.:|...||..:..|
Zfish   686 --IAFLRLVTTLVKGQLGSTQSRGLIPCVLLVLKEMLPTYHKWRYNTYGVRERIGCLILELVHAI 748

  Fly   744 LDLFNTAKESNCKQRELLVKVCVYSLLNLENGLILLRFVGVGNAYVQYTMELETNWMQQQPHG-- 806
            |:| |...||. .....|..:|:|||.|.|.|..::..:|||...:...:..:.:....:..|  
Zfish   749 LNL-NQECESE-GSAPSLQSLCIYSLANTEAGQAVVNIMGVGVDTINMVLAAQPSSGGSEGPGQV 811

  Fly   807 LMMLVRLSMRILMQLLRLKEEVYGNSETLSPLEALIYTQPKQRDTLRIIPTVCSYMSNIFDRWLP 871
            |:..|:|:..:...::|||.:    |:|.||||..:.......:.|  |..:..|:.:..|..||
Zfish   812 LIQTVKLAFSVTNNVIRLKPQ----SDTASPLEQALTQHGGHGNNL--IAVLAKYIYHKHDPALP 870

  Fly   872 ILSCRLLKRIALQFNMSLLACLDMEADQIRLTFMQKLPDELESDSIKIAILELVDACIAKQPGVT 936
            .|:.:||||:|....||:.|||..:|..||..|:.:|....|...||:.|||.:...:..|||:.
Zfish   871 RLAIQLLKRLATVAPMSVYACLGSDAAAIRDAFLTRLQSRTEDMRIKVTILEFLTVAVETQPGLI 935

  Fly   937 EAFFKVNYALDKRSRSFFSKDCVPNIGE-SIVTYMRDFLDALQVDPLTIQQALPAKIMTIFHSMW 1000
            |.|..    |:.:..|..:|:.  ::|| |.::.:.:.||:.|.........|....:...|::|
Zfish   936 ELFLN----LETKDASDGAKEF--SLGEWSCLSVVLELLDSKQQGKYWCPPLLQRAALAFLHALW 994

  Fly  1001 KHNLQMLVDDLVKDKQFWKKLCSPLFSELQPN--------LRIYTQLLNIISIEVY--TGNGNNA 1055
            :......:..|...::||:.|.:|||..|.|.        |.....::.||::|:|  .......
Zfish   995 QDRRDSALSVLRTKEKFWENLTTPLFGNLPPPSETTEPCVLESCAFVMKIIALEIYYVVSGVLEP 1059

  Fly  1056 ALLDVMNKFFEQKNFGPWLNYVFNMPKV------PAVKNLSSSDHLPDWICCLQAFKDLIVIL-- 1112
            :|...:..|..::.:..|.:||..:..|      ..:::||.|..|      :.|::.|:::.  
Zfish  1060 SLKAALESFSSKRRYEFWSDYVRELVCVACDGEEEGLRSLSESQML------ISAWRTLLILSTS 1118

  Fly  1113 ------LK----KQPKFVTIPE--SQFKLMAQK--CLVVLVDRSNYLEDMRPFIILAELYVFILL 1163
                  ||    :|..|:.:.|  ....||:|.  ||             |...::..|.:.:|.
Zfish  1119 HSEVMHLKDDTVRQKLFMDVLEGTKAALLMSQSVFCL-------------RLGSMMVTLLLILLK 1170

  Fly  1164 EFKHAYTDS--------------LEEEQTLMD---------LLL----------------QLMNR 1189
            ::|.....:              |..||.|||         |:|                ||:..
Zfish  1171 QWKSVLVSAPALLPPLSLMLESVLHAEQQLMDRTKAKLLSGLILALQIQGLNGGEISQLPQLLLC 1235

  Fly  1190 ICACYEDQHVRAKEACLAIVTKCTHLYTDLLIRDSSIALRFLNSVVGIICSELQHMENSVSLEKS 1254
            :|...:|:       .||::....|:.....:::.|:.            ::..|::        
Zfish  1236 VCEMVQDE-------ALALIDSTRHMIQRGDVQEDSME------------TDSPHVQ-------- 1273

  Fly  1255 QGLNNSDSSDSKTSTNSLILCLNLLKAVATIFHNDGPGNWDLPFVSVRLFQRLVRCVSR-TLPLF 1318
                 .|..||     ..:|.|:|.|.:... ..||. .|   ...||....|...:|. .|.|.
Zfish  1274 -----KDQQDS-----VCVLALHLSKELCRA-DEDGE-QW---LQVVRKLPVLPSVLSALELSLR 1323

  Fly  1319 SKQVL-----SVQLLDVLIVFAKGHCSVEFLHCDVGEYLWLKLLPPRE--LLQSKHEFTKTTAAD 1376
            |||.|     ::.||..|....:|..:|  ....|.:.:.|.||...|  ...:...|.: ...|
Zfish  1324 SKQNLYFTEAALHLLLTLARTPQGAAAV--AGAGVIQSICLPLLSVYEGPANGANQAFVR-KCQD 1385

  Fly  1377 AEGWTVEQWWPVYARGIELVTIIYEKHKKCFLEDAFQFVGIHAVFLEDAL--LLSKQSLEPSAMY 1439
            |..|.     .||...:.|:..:.:..:..|:.:|..|||:|...:...|  :.:.|||  :.:.
Zfish  1386 APSWP-----GVYRLSLSLMESLLKTLRYNFINEALDFVGVHQERILQCLNAVRTVQSL--ACLD 1443

  Fly  1440 LIKAAVNLVASLTEHHKEWKQDSDLSLANLMRAVQSLLC----------HTSSLFH---QQKNLK 1491
            .....|..:..|:...|||:    ..|..|:|.||..||          |:..:.|   |.||.:
Zfish  1444 EADHTVGFLLQLSNFCKEWQ----FHLPQLLRDVQVNLCYLCQTCTYLLHSKKMLHHYLQAKNGE 1504

  Fly  1492 CLLAGRRSQLEILRSTEALI------VDDELISA--CNDLTDIIISCVKALLRFSPDLMELLCCS 1548
            .|..|...|..:..:::.|:      .:.:.:.|  |: |..|:...:..|..|:||..::|...
Zfish  1505 GLPQGPHPQRALQPASKELLEGEREEAESKALQAVQCS-LLKILSKTLATLQHFTPDCCQILLDQ 1568

  Fly  1549 AYEPSKHSILLDVKFGAPKLNEENLTLTFGIVLNLVNIYVKALNMQNHGFSEVPLNSLPNVEHSG 1613
            |.:.:::..|..:.|..|.. :.::..:||.::..:|:   ||:|    ..|:.....|      
Zfish  1569 AMDLAEYRTLFVLSFSTPAF-DSDVAPSFGTLMATINV---ALSM----LGEIEKKKEP------ 1619

  Fly  1614 DNDDPEVCVGNQTNRTFSKPLSNVSISTGTCPASELLSNMDGQ----LCLLALEHLLMLVASQAI 1674
                                               |:|:.|.|    |.:.::|:...::.|||:
Zfish  1620 -----------------------------------LISSEDTQALKSLLMFSMENCFYVLVSQAV 1649

  Fly  1675 CIIRSPNLETLWKQIVRRDISNEL 1698
            ..::.|.:....||.:::::|:||
Zfish  1650 RCLKDPAVSHRDKQRLKQELSSEL 1673

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Nup188NP_001246283.1 Nup188 31..943 CDD:287461 246/963 (26%)
nup188XP_001923018.1 Nup188 29..942 CDD:287461 247/968 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C354863868
eggNOG 1 0.900 E1_KOG4833
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 216 1.000 Inparanoid score I3521
OMA 1 1.010
OrthoDB 1 1.010 D201834at33208
OrthoFinder 1 1.000 FOG0005680
OrthoInspector 1 1.000 T1051571
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR31431
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R4870
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
1110.940

Return to query results.
Submit another query.