DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Nup188 and Nup188

Sequence 1:NP_001246283.1 Gene:Nup188 FlyBaseID:FBgn0033766 Length:1866 Species:Drosophila melanogaster
Sequence 2:XP_006224402.1 Gene:Nup188 RGDID:1306022 Length:1754 Species:Rattus norvegicus

Alignment Length:1846 Identity:423/1847 (23%)
Similarity:741/1847 (40%) Gaps:306/1847 (17%)


  Fly     2 PAVEKSVITDWKRLWPMVSGIHYETPQDTVREELMNVASELQAGVLQFKPKNASSLELGTLLKEK 66
            |.|..|     :.||.::.|.......:.:..||......|..|:..::|.:.||.|   .:|..
  Rat     8 PCVRSS-----RELWTILLGRSALRELNQIEAELNKHWQRLLEGLSYYRPPSPSSAE---RVKAN 64

  Fly    67 KQEKLLPFTE---RLQDLLDLESAQCWEILCYYLTQEYRGSASLLTQLISTETNMAKLHEDIRHY 128
            | :...|..|   |:...|.|:..|..::|..||.:.|||:...|..::..|.....|...|..|
  Rat    65 K-DVASPLKELGLRVSKFLGLDEEQSVQLLQCYLQEAYRGTRDSLKTVLQDERQSQALTLKIADY 128

  Fly   129 YSLERMVVLKIVKNLIVFHQVPNHPYHREYRAVVEKITIPRLRDSYLDQLESLICEVPPRKLMAG 193
            |..||..:|:.|.:|:.:.|...|||..||...|:|:. ..|...|..|.|.|.....|.....|
  Rat   129 YYEERTCILRCVLHLLTYFQDERHPYRAEYADCVDKLE-KELVLKYRQQFEELYRTEAPTWETHG 192

  Fly   194 ECFHSAERLVA-WSERNAREINEVLHILLVLAEHLPMGLEQIKRIFAACKQHSFGKMQS---YLD 254
            ...  .||.|: |..:..||.:.:|.|:.:...:..|....:..:....|:..||..|:   .:|
  Rat   193 NLM--TERQVSRWFVQCLREQSMLLEIIFLYYAYFEMAPSDLLVLTKMFKEQGFGSRQTNRHLVD 255

  Fly   255 DS-QPYHQEIIRSLSYSELMLVLKCLDFE---------KPEKHSDLIEKLI-EDLQVDIASMYHR 308
            :: .|:    :..:.|...:::::.:|.|         :.|.|....:.|| :|:...:.::...
  Rat   256 ETMDPF----VDRIGYFSALILVEGMDIESLHKYALDDRRELHQFAQDGLICQDMDRIMLTLGDI 316

  Fly   309 PEHGPLLLAWMLLRLRGTNDADDASSLLRCRQLGKRAVDLKCFVQLHLIARHSMYADDSMLSRIV 373
            |.|.|:||||.|  ||.|.:.::.||::  |::|..|:.|..|..|..:.|......:...:...
  Rat   317 PHHAPVLLAWAL--LRHTLNPEETSSVV--RKIGGTAIQLNVFQYLTRLLRSLASGGNDCTTSTA 377

  Fly   374 RRTIYNQVGYLCDLFDGDGSCARYEGIYELLCELVSWPHLAKDFCSRED--------DGPCSLYK 430
            ...:|..:.:.....:.. :....:.:.:..||:::.|.|.:.|...|.        |..|.::.
  Rat   378 CMCVYGLLSFALTSLELH-TLGNQQDVIDTACEVLADPSLPELFWGTEPTSGLGIILDSVCGMFP 441

  Fly   431 TLLENFPLELTHLSKLALSLTKAGQGNYVKSQLEALPILALRYDE-SQHKLREVDTNEFELLASV 494
            .||.  ||    |..|...::.......|.|.|:.:..    |:| .:||..:|.::|...|...
  Rat   442 HLLS--PL----LQLLRALVSGKSTAKKVYSFLDKMSF----YNELHKHKPHDVLSHEDGTLWRR 496

  Fly   495 QPFQ-------QIDFTIPAGTSCTAIQHPSGCFMHFRFPVNYFDALHHEINCLLRETGHLHGDFE 552
            |..:       |.:..||.||....:.......:.:.:..:.:.....||..||    |:....:
  Rat   497 QTPKLLYPLGGQTNLRIPQGTVGQVMLDDRAYLVRWEYSYSSWTLFTCEIEMLL----HVVSTAD 557

  Fly   553 SSERIRNVEAGLRFLESAVKLSQSISGISAEMVHP-TEMCVDLLHTFKSVQYPPVGLLSSCLNVC 616
            ..:..:.|:..:..:...:....||    |:.:.| |.....||....:|..|||.:::||:|..
  Rat   558 VIQHCQRVKPIIDLVHKVISTDLSI----ADCLLPITSRIYMLLQRLTTVISPPVNVIASCVNCL 618

  Fly   617 TALLPLVDEEIFSRISNLHILPTVSPGSHYDFKMYANANGVGFESRFLGSVIDNVEKKRERYEFL 681
            |.|......::::.:.:...||.|   :|....|....:..|..:...||::.|.|:.:..|...
  Rat   619 TVLAARNPAKVWTDLRHTGFLPFV---AHPVSNMTQMISAEGMNAGGYGSLLMNSEQPQGEYGVT 680

  Fly   682 LSYIGFLRAYSNLKRNR----QIQMEIPGLIFLLKDVFPHLHTWHFSSQVERNKIYFEILSFICD 742
               :.|||..:.|.:.:    |.|..:|.::|:||:|.|..|.|.:||...|..|...||..|..
  Rat   681 ---VAFLRLVTTLVKGQLGSTQSQGLVPCVMFVLKEVLPSYHKWRYSSHGVRELIGCLILELIHA 742

  Fly   743 ILDLFNTAKESNCKQREL-------LVKVCVYSLLNLENGLILLRFVGVGNAYVQYTMELETNWM 800
            ||:|        |::.||       |..:|:.||...|.|..::..:|:|...:...|..:..  
  Rat   743 ILNL--------CQETELHSSHTPSLPSLCICSLAYTEAGQTVISIMGIGVDTIDMVMAAQPR-- 797

  Fly   801 QQQPHG------LMMLVRLSMRILMQLLRLKEEVYGNSETLSPLEALIYTQPKQRDTLRIIPTVC 859
            ...|.|      |:..|:|:..:...::|||..    |..:||||..:.......:.|  |..:.
  Rat   798 SDGPEGQGQGQLLIKTVKLAFSVTNNVIRLKPP----SNVVSPLEQALTQHGAHGNNL--IAVLA 856

  Fly   860 SYMSNIFDRWLPILSCRLLKRIALQFNMSLLACLDMEADQIRLTFMQKLPDELESDSIKIAILEL 924
            .|:.:..|..||.|:.:||||:|....||:.|||..:|..||..|:.:|..::|...||:.|||.
  Rat   857 KYIYHRHDPALPRLAIQLLKRLATVAPMSVYACLGSDAAAIRDAFLTRLQSKIEDMRIKVMILEF 921

  Fly   925 VDACIAKQPGVTEAFFKVNYALDKRSRSFFSKDCVPNIGE-SIVTYMRDFLDALQVDPLTIQQAL 988
            :...:..|||:.|.|..    |:.:..|..||:.  ::|. |.:..:.:.:|:.|.|.......|
  Rat   922 LTVAVETQPGLIELFLN----LEVKDGSSGSKEF--SLGVWSCLHVVLELIDSQQQDRYWCPPLL 980

  Fly   989 PAKIMTIFHSMW--KHNLQMLVDDLVKDKQFWKKLCSPLFSELQPN--------LRIYTQLLNII 1043
            ....:...|::|  :.:..|||  |....:||:.|.||||..|.|.        |.....::.||
  Rat   981 HRAAIAFLHALWQDRRDSAMLV--LRTKPRFWENLTSPLFGTLSPPSETSEPSILETCALIMKII 1043

  Fly  1044 SIEVY--TGNGNNAALLDVMNKFFEQKNFGPWLNYVFNMPKVPAVKNLSSSDHLPDWICCLQAFK 1106
            .:|:|  .....:.:|.|.:.||..:|.|..|..||.::....|....:|...|.::...:.|::
  Rat  1044 CLEIYYVVKGSLDQSLKDTLKKFSSEKRFAYWSGYVKSLAVYMAETEGNSCTSLLEYQMLVSAWR 1108

  Fly  1107 DLIVI------------LLKKQPKFVTIPESQFKLMAQKCLVVLVDRSNYLEDMRPFIILAELYV 1159
            .|:::            :..::..|:.:      |...|.|:::....|.|   |...::..|.:
  Rat  1109 TLLIVATSHADIMNLTDVAVRRQLFLDV------LDGTKALLLVATSVNCL---RLGSMMCTLLL 1164

  Fly  1160 FILLEFKHAYTDSLEEEQTLMDLLLQLMNRIC--ACYEDQHVRAKE-----ACLAIVTKCTHLYT 1217
            .:|.::|        .|...:|.:|..:..:.  ....||.:..|.     :....|.:...|..
  Rat  1165 ILLRQWK--------RELGAVDKILGPLTEVLEGVLQADQQLMEKTKAKVFSAFITVLQMKELRV 1221

  Fly  1218 DLLIRDSSIALRFLNSVVGIICSELQHMENSVSL--EKSQGLNNSDSSDSKTSTNS--------- 1271
            ..:.:.|.:.|.        :|..||  |..::|  :....|.:..:::.|.|..:         
  Rat  1222 SEIPQYSQLVLN--------VCETLQ--EEVIALFDQTRHSLASGSAAEDKDSMETDDCPRPRHK 1276

  Fly  1272 -------LILCLNLLKAVATIFHNDGPGNW-----DLPF---------VSVRLFQRLVRCVSRTL 1315
                   .:|.|:|.|.:..: ..|| .:|     .||.         ||:|:.|.|        
  Rat  1277 DQRDGQVCVLGLHLAKELCEV-DEDG-DSWLQVTRRLPILPTLLTTLEVSLRMKQNL-------- 1331

  Fly  1316 PLFSKQVLSVQLLDVLIVFAKGHCSVEFLHCDVGEYLWLKLLPPRELLQSKHEFTKTTAADAEGW 1380
             .|::..|  .||..|....:|..:|  ....:.:.:.|.||...:|  |.:...:|.:...:..
  Rat  1332 -HFTEAAL--HLLLTLARTQQGATAV--AGAGITQSICLPLLSVYQL--SSNGTGQTPSTSRKSL 1389

  Fly  1381 TVEQWWPVYARGIELVTIIYEKHKKCFLEDAFQFVGIHAVFLEDAL--LLSKQSLEPSAMYLIKA 1443
            ....|..||...:.|:..:.:..:..||.:|..|||:|.......|  :.:.|||  :.:.....
  Rat  1390 DAPSWPGVYRLSMSLMERLLKTLRYNFLTEALDFVGVHQERTLQCLNAVRTVQSL--ACLEEADH 1452

  Fly  1444 AVNLVASLTEHHKEWKQDSDLSLANLMRAVQ---SLLCHT-SSLFHQQKNLKCLLAGRR------ 1498
            .|..:..|:...|||    ...|..|||.||   ..||.. :||.|.:|.|:..|..:.      
  Rat  1453 TVGFILQLSHFRKEW----HFHLPQLMRDVQVNLGYLCQACTSLLHSRKMLQHYLQNKNGDGLPS 1513

  Fly  1499 ----------SQLEILR-----STEALIVDDE------LISACNDLTDIIISCVKALLRFSPDLM 1542
                      :...:|.     |::..|.|.|      |.:....|..|:...:.||..|:||:.
  Rat  1514 AVTPRVHRPSTTTTVLATPSGCSSKQPIADTEASEQRALHTVQYGLLKILSRTLAALRHFTPDVC 1578

  Fly  1543 ELLCCSAYEPSKHSILLDVKFGAPKLNEENLTLTFGIVLNLVNIYVKALNMQNHGFSEVPLNSLP 1607
            ::|...:.:.::::.|..:.|..|..:.| :..:||.:|..||:   ||||         |..|.
  Rat  1579 QILLDQSLDLAEYNFLFALSFTTPTFDSE-VAPSFGTLLATVNV---ALNM---------LGELD 1630

  Fly  1608 NVEHSGDNDDPEVCVGNQTNRTFSKPLSNVSISTGTCPASELLSNMDGQLCLLALEHLLMLVASQ 1672
            ..:.|...     .||..|....::.|.:                    |.:..:|:...|:.||
  Rat  1631 KKKESLTQ-----AVGLSTQAEGTRTLKS--------------------LLMFTMENCFYLLISQ 1670

  Fly  1673 AICIIRSPNLETLWKQIVRRDISNEL 1698
            |:..:|.|.:....||.:::::|:||
  Rat  1671 AVRYLRDPAVHPRDKQRMKQELSSEL 1696

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Nup188NP_001246283.1 Nup188 31..943 CDD:287461 237/964 (25%)
Nup188XP_006224402.1 Nup188 31..941 CDD:287461 235/962 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C354861767
eggNOG 1 0.900 E1_KOG4833
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D201834at33208
OrthoFinder 1 1.000 FOG0005680
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR31431
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.950

Return to query results.
Submit another query.