DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Nup188 and nup184

Sequence 1:NP_001246283.1 Gene:Nup188 FlyBaseID:FBgn0033766 Length:1866 Species:Drosophila melanogaster
Sequence 2:NP_593414.1 Gene:nup184 PomBaseID:SPAP27G11.10c Length:1564 Species:Schizosaccharomyces pombe

Alignment Length:1625 Identity:303/1626 (19%)
Similarity:537/1626 (33%) Gaps:533/1626 (33%)


  Fly    24 YETPQDTVR----EELMNVASELQAGVLQFKPKNASSLELGTLLKEKKQE----KL--------- 71
            :||..:.:.    |||      |.|.:..|  :...|...|||...|..|    ||         
pombe    15 FETSDENLSQNKFEEL------LDARIAAF--QQIESPVTGTLNSNKTTEGEEAKLSIYDSSHSI 71

  Fly    72 ----LPFTERLQDLLDLESAQCWEILCYYLTQEYRGSASLLTQLISTETNMAKLHEDIRHYYSLE 132
                |...:::.|:.....||...:|   |..:|    .|.||..|...|.:.|.::.:..|..|
pombe    72 SKSQLESVKKISDITGYNEAQVAYVL---LVHQY----ELNTQYFSQLDNDSVLAQEFQRRYYAE 129

  Fly   133 RMVVLKIVKNLIVFHQVPNHPYHREYRAVVEKI--TIPRLRDS------------YLDQLESLIC 183
            .:...|::..|:......:..:|:....::..|  |..|..::            .:|.|..:..
pombe   130 IISCWKVLAFLLQACTDADSKWHKMATRLIVSIFQTAQRSGENAQSTTPSIFCVRIIDYLSKMTS 194

  Fly   184 EVPPRKLMAGECFHSAERLVAWSERNAREINEVLHILLVLAEHLPMGLEQIKRIF------AACK 242
            :..|..|    .|:..|.:..|                 ...|..:.|:.::.||      ..|.
pombe   195 QAAPASL----TFNGEEAISQW-----------------YFFHFNLQLQLLRVIFLSTYSLVVCN 238

  Fly   243 QHS----FGKMQS--YLDDSQPYHQEIIRSLSY-SEL--MLVLKCLDFEKPEKH----------- 287
            ...    |..|:.  ||.|.:..|.:|....|. .|:  :.::..::|...||.           
pombe   239 SEMAISWFNCMKKTRYLHDQEFMHLDIDTGFSMCKEITNVAIIISINFISLEKQVLSFKDNPSFF 303

  Fly   288 ----------SDLIEKLIED-------LQVDIA--SMYHRPEHGPLLLAWMLLRLRGTNDADDAS 333
                      .|:|.:|..|       |...||  .:.:.|::.||:          .|.:..:|
pombe   304 MLSGNTIISLHDMITQLSNDSIGAAVSLTWGIALHLLSNSPDNIPLI----------QNSSVVSS 358

  Fly   334 SLLRCRQLGKRAVDLKC-----FVQLHLIARHSMYADDSML---SRIVRRTIYNQVGY------- 383
            .:|:..|...:|:.:..     |..:|.|.  |...||..:   |:|:.....:.|.|       
pombe   359 KILQNPQNSFQALIIAALKYDPFTLIHRII--SSLEDDPYIDGYSKIMATLFSSAVSYVKFSDST 421

  Fly   384 -LC-----------DLFDGDGSC--------ARYEGIYELLCELVSWPHLAKDFCSREDDGPCSL 428
             ||           .||:.:.|.        ||:...|.... |:..|..|           |..
pombe   422 MLCATTLFKTPQVYQLFENNDSVTRLLNFARARFPFEYSQFV-LLLIPTFA-----------CLT 474

  Fly   429 YKTLLENFPLELTHLSKLALSLTKAGQGNYVKSQLEALPILALRYDESQHKLREVDTNEFELLAS 493
            .|.|:.:   ||.|::....||....:...:..:........:...||.|    :|:..|.    
pombe   475 SKQLVSS---ELLHMTTFTQSLPSGFKAYEIIPEPNVTGNALIELQESLH----LDSYGFF---- 528

  Fly   494 VQPFQQIDFTIPAGTSCTAIQ---HPSGCFMHFRFPV-----NY--FDALHHEINCLLRETG--H 546
               |...:.::|.||....:.   :|         ||     ||  ::|:...:|.::| .|  :
pombe   529 ---FPNAERSLPKGTRGRIVSVDTYP---------PVVMWDLNYSLWEAVGISLNYIVR-NGLIN 580

  Fly   547 LHGDFESSERIRNVEAGLRFLESAVKLSQS-ISGISAEMVHPTE------------MCVDLLHTF 598
            .|..|.           |..|.|:|.|.|: :|| :.|:||...            :| |||..|
pombe   581 SHKSFV-----------LTVLSSSVPLFQTDVSG-ACELVHLASEGLDGELDFINVIC-DLLDYF 632

  Fly   599 KSVQYPPVGLLSSCLNVCTALLPLVDEEIFSRISNLHILPTVS-----PGSHYDFKM------YA 652
            .|:..    :..:...:|.:.|.|:.|  |:|.:...:...|:     .||.....:      |.
pombe   633 LSLSV----IEDADYQICVSSLRLLRE--FTRFAATDVWAYVTRSLVCVGSEKGISLEDVIFDYE 691

  Fly   653 NANGV-GFESRFLG------------SVIDNVEKKRERYEFLLSYIGFL---------RAYSNLK 695
            :.||| .|...|..            ||:.:....|.:.:|:...:.||         ..|:.:.
pombe   692 SINGVYDFTLAFFDLYEILLDNCISTSVVPDDFSIRLKTDFVKRAMRFLCEVFANYLDWKYARII 756

  Fly   696 RNRQIQMEIPGLIFLLKDV----------------------FPHLHTWHFSSQVERNKIYFEILS 738
            :..||......||..|.:|                      ..|.....|..|.:.|:....:||
pombe   757 QQYQIGHRFASLITKLLNVTFGIEYFNPKTTVNKKTLPLRELSHYIVQRFLVQQDSNRYLHPLLS 821

  Fly   739 FICDIL-----DLFNTAKESNCKQREL-LVK--------VCVYSLLNLENGLILLRFVGVGNAYV 789
             :.|::     |:|:|......|..:: |:.        :|:...|||:                
pombe   822 -VMDLINLLYTDIFSTISSPRAKAAKMWLISSFCAMKTLICLRGFLNLK---------------- 869

  Fly   790 QYTMELETNWMQQQPHGLMMLVRLSMRILMQLLRLKEEVYGNSETLSPLEALIYTQPKQRDTLRI 854
              ..|||.....:.|.....|.|| :..:..:|:|             |.|||.. |...:|   
pombe   870 --PSELERELFSRSPDLFNCLPRL-LCCIAPILQL-------------LSALILA-PWPSET--- 914

  Fly   855 IPTVCSYMSNIFDRWLPILSCRLLKRIALQFNMSLLACLDMEADQIRLTFMQKLPDELESDSIKI 919
             |::.:||.|..|         ::.|:.:|.                      |.:.::|.:|:.
pombe   915 -PSLLAYMINSTD---------IVGRVCIQI----------------------LTNPIQSTNIEG 947

  Fly   920 AILELVDACI-AKQPGVTEAFFK-VNYALDKRSRSFFSKDCVPNIGESIVTYMRDFLDALQVDPL 982
            ::.:.:.:.: .:|.|:....|. ..:.|| |.:|......|....:|:::.....||:..::.:
pombe   948 SVWKFLSSIMKGQQQGLAVLLFSGKKFPLD-RMKSLNHNVDVQLTSKSLISLAEKRLDSFSINDI 1011

  Fly   983 TIQQALPAKIMTIFHSMWKHNLQMLVDDLVKDKQFWKKLCS----PLFSEL-------QPNL--- 1033
             :.|....:.:.:..:.|..:|    .:|.::..||.::..    ||..:|       |.:|   
pombe  1012 -LSQVPVFEFIFLSRNFWTASL----GNLQQEANFWNRIVDAIKLPLTVKLDGLSSVAQADLYIL 1071

  Fly  1034 ----------RIYTQLLN-----------------------IISIEVYTGNGNNAALLDVMNKFF 1065
                      :::...||                       ..:|..|..|.:||     :.:.|
pombe  1072 AAHATRITAIQLHMSKLNKSNSSKKIIIDPLKDSMKDLVQHAFTITAYDSNIHNA-----LTRAF 1131

  Fly  1066 EQKN-----------------FGPWLNYVFNMP------------------KVPAVKNLSSSDH- 1094
            :.:|                 :|.  ||.:|:.                  .:.|.:|||..|. 
pombe  1132 KHENGDLHISDLRNTGLFPLRYGD--NYFYNIKLAKNMLLNTEDTSFKISMMMSANENLSLLDAQ 1194

  Fly  1095 ---LPDWICCLQAFKDLIVILLKKQPKFVTIPESQFKLMAQKCLVVLVDRSNYLEDMRPFIILAE 1156
               |..|...:.||.:.:     |:...::|.|.:......|.|.         ||.....::.|
pombe  1195 AALLRSWSIFICAFVEFV-----KEDATLSILELKIMKWVLKSLA---------EDTIDVNVVQE 1245

  Fly  1157 L------YVFILLEFKHAYTDSLEEEQTLMDLLLQLMNRIC----ACYEDQHVRAKEACLAIVTK 1211
            |      .||.:.:...|...|.|.::.|..:||.....|.    :.|||.:..     :|....
pombe  1246 LSAERAALVFRISQQTLAIPISNEVKEHLQSILLLTWKAITTTKFSIYEDSNGE-----MAYYRP 1305

  Fly  1212 CTHLYTDLLIRDSSIALRFLNSVVGIICSELQ--HMENSVSLEKSQGLNNSDSSDSKTSTNSLIL 1274
            ..|:..:.|.|..|.....|:..||.:...||  |.:.|...||:......:........|||..
pombe  1306 LLHVLYNTLNRLLSEEKENLSLSVGFVSGLLQLCHRKLSQLFEKAVINPTIEVYGDIVLLNSLHK 1370

  Fly  1275 CL---NLLKAVATIFHNDGPGNWDLPFVS--------VRLFQRLVRCVSRTLPLFSKQVLSVQLL 1328
            |:   :|::.:.:::         :.:::        :|||......:....|.|:...||..|:
pombe  1371 CIVNSHLIRGLQSLY---------ISYINDSFSVDNCLRLFSWSHSLLVDGQPYFADAALSFLLI 1426

  Fly  1329  1328
            pombe  1427  1426

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Nup188NP_001246283.1 Nup188 31..943 CDD:287461 212/1123 (19%)
nup184NP_593414.1 Nup188 50..972 CDD:287461 202/1086 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR31431
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.100

Return to query results.
Submit another query.