DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Nup188 and Nup188

Sequence 1:NP_001246283.1 Gene:Nup188 FlyBaseID:FBgn0033766 Length:1866 Species:Drosophila melanogaster
Sequence 2:NP_938046.2 Gene:Nup188 MGIID:2446190 Length:1759 Species:Mus musculus

Alignment Length:1847 Identity:426/1848 (23%)
Similarity:737/1848 (40%) Gaps:303/1848 (16%)


  Fly     2 PAVEKSVITDWKRLWPMVSGIHYETPQDTVREELMNVASELQAGVLQFKPKNASSLELGTLLKEK 66
            |.|..|     :.||.::.|.......:.:..||......|..|:..:||.:.||.|   .:|..
Mouse     8 PCVRSS-----RELWTILLGRSALRELNQIEAELNKYWQRLLEGLSYYKPPSPSSAE---RVKAN 64

  Fly    67 KQEKLLPFTE---RLQDLLDLESAQCWEILCYYLTQEYRGSASLLTQLISTETNMAKLHEDIRHY 128
            | :...|..|   |:...|.|:..|..::|..||.::|||:...|..::..|.....|...|..|
Mouse    65 K-DVASPLKELGLRVSKFLGLDEEQSVQLLQCYLQEDYRGTRDSLKTVLQDERQSQALTLKIADY 128

  Fly   129 YSLERMVVLKIVKNLIVFHQVPNHPYHREYRAVVEKITIPRLRDSYLDQLESLICEVPPRKLMAG 193
            |..||..:|:.|.:|:.:.|...|||..||...|:|:. ..|...|..|.|.|.....|.....|
Mouse   129 YYEERTCILRCVLHLLTYFQDERHPYRAEYADCVDKLE-KELVLKYRQQFEELYRTEAPTWETHG 192

  Fly   194 ECFHSAERLVA-WSERNAREINEVLHILLVLAEHLPMGLEQIKRIFAACKQHSFGKMQS--YL-- 253
            ...  .||.|: |..:..||.:.:|.|:.:...:..|....:..:....|:..||..|:  :|  
Mouse   193 NLM--TERQVSRWLVQCLREQSMLLEIIFLYYAYFEMAPSDLLVLTKMFKEQGFGSRQTSRHLVG 255

  Fly   254 DDSQPYHQEIIRSLSYSELMLVLKCLDFE---------KPEKHSDLIEKLI-EDLQVDIASMYHR 308
            ....|:    :..:.|...:::::.:|.|         :.|.|....:.|| :|:...:.::...
Mouse   256 GTMDPF----VDRIGYFSALILVEGMDIESLHKYALDDRRELHQFAQDGLICQDMDRAMLTLGDI 316

  Fly   309 PEHGPLLLAWMLLRLRGTNDADDASSLLRCRQLGKRAVDLKCFVQLHLIARHSMYADDSMLSRIV 373
            |.|.|:||||.|  ||.|...::.||::  |::|..|:.|..|..|..:.|......:...:...
Mouse   317 PHHAPVLLAWAL--LRHTLSPEETSSVV--RKIGGTAIQLNVFQYLTRLLRSLASGGNDCTTSTA 377

  Fly   374 RRTIYNQVGYLCDLFDGDGSCARYEGIYELLCELVSWPHLAKDFCSRED--------DGPCSLYK 430
            ...:|..:.:.....:.. :....:.:.:..||:::.|.|.:.|...|.        |..|.::.
Mouse   378 CMCVYGLLSFALTSLELH-TLGNQQDVIDTACEVLADPSLPELFWGTEPTSGLGIILDSVCGMFP 441

  Fly   431 TLLENFPLELTHLSKLALSLTKAGQGNYVKSQLEALPILALRYDE-SQHKLREVDTNEFELLASV 494
            .||.  ||    |..|...::.......|.|.|:.:..    |:| .:||..:|.::|...|...
Mouse   442 HLLS--PL----LQLLRALVSGKSTAKKVYSFLDKMSF----YNELHKHKPHDVLSHEDGTLWRR 496

  Fly   495 QPFQ-------QIDFTIPAGTSCTAIQHPSGCFMHFRFPVNYFDALHHEINCLLRETGHLHGDFE 552
            |..:       |.:..||.||....:.......:.:.:..:.:.....||..||    |:....:
Mouse   497 QTPKLLYPLGGQTNLRIPQGTVGQVMLDDRAYLVRWEYSYSSWTLFTCEIEMLL----HVVSTAD 557

  Fly   553 SSERIRNVEAGLRFLESAVKLSQSISGISAEMVHP-TEMCVDLLHTFKSVQYPPVGLLSSCLNVC 616
            ..:..:.|:..:..:...:....||    |:.:.| |.....||....:|..|||.:::||:|..
Mouse   558 VIQHCQRVKPIIDLVHKVISTDLSI----ADCLLPITSRIYMLLQRLTTVISPPVNVIASCVNCL 618

  Fly   617 TALLPLVDEEIFSRISNLHILPTVSPGSHYDFKMYANANGVGFESRFLGSVIDNVEKKRERYEFL 681
            |.|......::::.:.:...||.|   :|....|....:..|..:...||::.|.|:.:..|...
Mouse   619 TVLAARNPAKVWTDLRHTGFLPFV---AHPVSNMTQMISAEGMNAGGYGSLLMNSEQPQGEYGVT 680

  Fly   682 LSYIGFLRAYSNLKRNR----QIQMEIPGLIFLLKDVFPHLHTWHFSSQVERNKIYFEILSFICD 742
               |.|||..:.|.:.:    |.|..:|.::|:||::.|..|.|.::|...|..|...||..|..
Mouse   681 ---IAFLRLVTTLVKGQLGSTQSQGLVPCVMFVLKEMLPSYHKWRYNSHGVRELIGCLILELIHA 742

  Fly   743 ILDLFNTAKESNCKQREL-------LVKVCVYSLLNLENGLILLRFVGVGNAYVQYTMELETNWM 800
            ||:|        |::.||       |..:|:.||...|.|..::..:|:|...:...|..:..  
Mouse   743 ILNL--------CQETELHSSHTPSLPSLCICSLAYTEAGQTVISIMGIGVDTIDMVMAAQPR-- 797

  Fly   801 QQQPHG------LMMLVRLSMRILMQLLRLKEEVYGNSETLSPLEALIYTQPKQRDTLRIIPTVC 859
            ...|.|      |:..|:|:..:...::|||..    |..:||||..:.......:.|  |..:.
Mouse   798 SDGPEGQGQGQLLIKTVKLAFSVTNNVIRLKPP----SNVVSPLEQALTQHGAHGNNL--IAVLA 856

  Fly   860 SYMSNIFDRWLPILSCRLLKRIALQFNMSLLACLDMEADQIRLTFMQKLPDELESDSIKIAILEL 924
            .|:.:..|..||.|:.:||||:|....||:.|||..:|..||..|:.:|..::|...||:.|||.
Mouse   857 KYIYHRHDPALPRLAIQLLKRLATVAPMSVYACLGSDAAAIRDAFLTRLQSKIEDMRIKVMILEF 921

  Fly   925 VDACIAKQPGVTEAFFKVNYALDKRSRSFFSKDCVPNIGE-SIVTYMRDFLDALQVDPLTIQQAL 988
            :...:..|||:.|.|..    |:.:..|..||:.  ::|. |.:..:.:.:|:.|.|.......|
Mouse   922 LTVAVETQPGLIELFLN----LEVKDGSNGSKEF--SLGVWSCLHVVLELIDSQQQDRYWCPPLL 980

  Fly   989 PAKIMTIFHSMW--KHNLQMLVDDLVKDKQFWKKLCSPLFSELQPN--------LRIYTQLLNII 1043
            ....:...|::|  :.:..|||  |....:||:.|.||||..|.|.        |.....::.||
Mouse   981 HRAAIAFLHALWQDRRDSAMLV--LRTKPKFWENLTSPLFGTLSPPSETSEPSVLETCALIMKII 1043

  Fly  1044 SIEVY--TGNGNNAALLDVMNKFFEQKNFGPWLNYVFNMPKVPAVKNLSSSDHLPDWICCLQAFK 1106
            .:|:|  .....:.:|.|.:.||..:|.|..|..||.::....|....||...|.::...:.|::
Mouse  1044 CLEIYYVVKGSLDQSLKDTLKKFSSEKRFAYWSGYVKSLAVYMADTEGSSCTSLLEYQMLVSAWR 1108

  Fly  1107 DLIVI------------LLKKQPKFVTIPESQFKLMAQKCLVVLVDRSNYLEDMRPFIILAELYV 1159
            .|::|            :..::..|:.:      |...|.|:::....|.|   |...::..|.:
Mouse  1109 ILLIIAASHADVMHLTDMAVRRQLFLDV------LDGTKALLLVAASVNCL---RLGSMMCTLLL 1164

  Fly  1160 FILLEFKHAYTDSLEEEQTLMDLLLQLMNRICACYEDQHVRAKEACLAIVTKCTHL-YTDLLIRD 1223
            .:|.::|.    .|...:.::..|.:::..:...  ||.:..|..........|.| ..:|.:.|
Mouse  1165 ILLRQWKR----ELGAVEKILGPLTEILEGVLQA--DQQLMEKTKAKVFSAFITVLQMKELRVGD 1223

  Fly  1224 ----SSIALRFLNSVVGIICSELQHMENSVSL--EKSQGLNNSDSSDSKTSTNS----------- 1271
                |.:.|.        :|..||  |..::|  :....|.:..:::.|.|..:           
Mouse  1224 IPQYSQLVLN--------VCETLQ--EEVIALFDQTRHSLASDSAAEDKDSMETDDCPRPRHKDQ 1278

  Fly  1272 ----LILCLNLLKAVATIFHNDGPGNW-----DLPF---------VSVRLFQRLVRCVSRTLPLF 1318
                .:|.|:|.|.:..: ..|| .:|     .||.         ||:|:.|.|         .|
Mouse  1279 RDGVCVLGLHLAKELCEV-DEDG-DSWLQVTRRLPILPTLLTTLEVSLRMKQNL---------HF 1332

  Fly  1319 SKQVLSVQLLDVLIVFAKGHCSVEFLHCDVGEYLWLKLLPPRELLQSKHEFTKTTAADAEGWTVE 1383
            ::..|  .||..|....:|..:|  ....:.:.:.|.||...:|  |.:...:|.:...:.....
Mouse  1333 TEAAL--HLLLTLARTQQGATAV--AGAGITQSICLPLLSVYQL--SSNGTGQTPSTSRKSLDAP 1391

  Fly  1384 QWWPVYARGIELVTIIYEKHKKCFLEDAFQFVGIHAVFLEDALLLSKQSLEPSAMYLIKAAVNLV 1448
            .|..||...:.|:..:.:..:..||.:|..|||:|.......|...|.....:.:......|..:
Mouse  1392 SWPGVYRLSMSLMERLLKTLRYNFLTEALDFVGVHQERTLQCLNAVKTVQSLACLEEADHTVGFI 1456

  Fly  1449 ASLTEHHKEWKQDSDLSLANLMRAVQ---SLLCHT-SSLFHQQKNLKCLLAGR-----------R 1498
            ..|:...|||    ...|..|||.||   ..||.. :||.|.:|.|:..|..:           |
Mouse  1457 LQLSHFRKEW----HFHLPQLMRDVQVNLGYLCQACTSLLHSRKMLQHYLQNKNGDGLPSAVTPR 1517

  Fly  1499 SQ-----LEILRSTEAL-----------IVDDE------LISACNDLTDIIISCVKALLRFSPDL 1541
            :|     .....:|.||           ..|.|      |.:....|..|:...:.||..|:||:
Mouse  1518 AQRPSTTTTTTTTTTALATPAGCSSKQPTADTEASEQRALHTVQYGLLKILSRTLAALRHFTPDV 1582

  Fly  1542 MELLCCSAYEPSKHSILLDVKFGAPKLNEENLTLTFGIVLNLVNIYVKALNMQNHGFSEVPLNSL 1606
            .::|...:.:.::::.|..:.|..|..:.| :..:||.:|..||:   ||||         |..|
Mouse  1583 CQILLDQSLDLAEYNFLFALSFTTPTFDSE-VAPSFGTLLATVNV---ALNM---------LGEL 1634

  Fly  1607 PNVEHSGDNDDPEVCVGNQTNRTFSKPLSNVSISTGTCPASELLSNMDGQLCLLALEHLLMLVAS 1671
            ...:.|...     .||..|....::.|.:                    |.:..:|:...|:.|
Mouse  1635 DKKKESLTQ-----AVGLSTQAEGTRTLKS--------------------LLMFTMENCFYLLIS 1674

  Fly  1672 QAICIIRSPNLETLWKQIVRRDISNEL 1698
            ||:..:|.|.:....||.:::::|:||
Mouse  1675 QAVRYLRDPAVHPRDKQRMKQELSSEL 1701

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Nup188NP_001246283.1 Nup188 31..943 CDD:287461 237/964 (25%)
Nup188NP_938046.2 Nup188 31..941 CDD:287461 235/962 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C354862105
eggNOG 1 0.900 E1_KOG4833
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 243 1.000 Inparanoid score I3272
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D201834at33208
OrthoFinder 1 1.000 FOG0005680
OrthoInspector 1 1.000 T1082158
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR31431
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R4870
TreeFam 00.000 Not matched by this tool.
1110.940

Return to query results.
Submit another query.