DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GLS and glsb

DIOPT Version :8

Sequence 1:NP_001163129.1 Gene:GLS / 36396 FlyBaseID:FBgn0261625 Length:775 Species:Drosophila melanogaster
Sequence 2:XP_693171.3 Gene:glsb / 564746 ZFINID:ZDB-GENE-030616-550 Length:635 Species:Danio rerio

Alignment Length:644 Identity:305/645 (47%)
Similarity:419/645 (65%) Gaps:31/645 (5%)


  Fly    15 LLTTQAQVLVHQRAKASAAEPVEDFDQETDLLKRA---KFGHTGKQLQQKIINEKNLRAPPLMNL 76
            :|..:|.:::.:..:.|....:.|..:....|..|   ...:.|:..:..|::.......||   
Zfish     1 MLQFRASIVLKELIQTSPKRLLSDIIRHKKTLPNAYCFSAANNGRISKLNIVHYGRCFIQPL--- 62

  Fly    77 VFANRKLSFYDTSS----TPKTKEDNAKLHREQEQR-------NAEDVLFDMFASEETGLISMGK 130
              |.|:.....|..    |...|:|........::|       :.||:||...| |....|...|
Zfish    63 --AGRRFLCTKTEGAIEPTETAKKDETVQEAAADKRRKAGILPSLEDLLFYSIA-EGQERIPAHK 124

  Fly   131 FLAGLKTTGIRRNDPRVRELMDNLKKVHKLNNYETGSSAETQHLNRETFKAVVAPNIVLIAKAFR 195
            |:..||.||:|..|||::|.||.||...|       |:::...|:|..||..|..||||:.:|||
Zfish   125 FITALKATGLRTGDPRLKECMDMLKVTLK-------STSDGVMLDRHLFKKCVQSNIVLLTQAFR 182

  Fly   196 QQFVIPDFTSFVKDIEDIYNRCKTNTLGKLADYIPQLARYNPDSWGLSICTIDGQRFSIGDVDVP 260
            ::||||||.||...|:.:|.:.:..:.|.:||||||||:::||.|.:|:||:||||.::||..||
Zfish   183 KKFVIPDFQSFASHIDTLYEKGRNLSGGLVADYIPQLAKFSPDLWAVSLCTVDGQRHTVGDTKVP 247

  Fly   261 FTLQSCSKPLTYAIALEKLGPKVVHSYVGQEPSGRNFNELVLDQNKKPHNPMINAGAILTCSLMN 325
            |.||||.|||.|||::...|.:.||.::|:||||..||:|.||::.||||||:|||||:..||:.
Zfish   248 FCLQSCVKPLKYAISVHDHGTEYVHRFIGKEPSGLRFNKLFLDEDDKPHNPMVNAGAIVCTSLIK 312

  Fly   326 ALVKPDMTSAEIFDYTMSWFKRLSGGEYIGFNNAVFLSEREAADRNYALGFYMRENKCFPKRTNL 390
            .|.    .:||.|||.|::.|:::|.||:||:||.|.||||:.|||:|:|:|::|.||||..|::
Zfish   313 QLA----GNAEKFDYVMNFLKKMAGNEYVGFSNATFQSERESGDRNFAIGYYLKEKKCFPDGTDM 373

  Fly   391 KEVMDFYFQCCSMETNCEAMSVIAASLANGGICPTTEEKVFRPEVIRDVLSIMHSCGTYDYSGQF 455
            ..|:|.|||.||:|..||:.||:||:|||||.||.|.|:|..||.:||.||:|||||.||:||||
Zfish   374 TAVLDLYFQLCSIEVTCESASVMAATLANGGFCPITGERVLSPEAVRDTLSLMHSCGMYDFSGQF 438

  Fly   456 AFKVGLPAKSGVSGGMMLVIPNVMGIFAWSPPLDHLGNTVRGLQFCEELVSMFNFHRYDNLKHLS 520
            ||.||||||||||||::||:||||||..||||||.|||:|||:|||.:|||:||||.||||:|.:
Zfish   439 AFHVGLPAKSGVSGGILLVVPNVMGIMCWSPPLDKLGNSVRGIQFCTDLVSLFNFHNYDNLRHFA 503

  Fly   521 NKKDPRKHRYETKGLSIVNLLFSAASGDVTALRRHRLSGMDITLADYDGRTALHLAASEGHLECV 585
            .|.|||:...:.:..|::||||:|.:|||:||||..||.:|:...|||.|||||:||:|||:|.|
Zfish   504 KKLDPRREGGDQRVKSVINLLFAAYTGDVSALRRFALSSVDMEQRDYDSRTALHVAAAEGHIEVV 568

  Fly   586 KFLLEQCHVPHNPKDRWGNLPVDEAENFGHCHVVEFLRSWAEKADQSSEECKPEAVTSK 644
            :||||.|.|...|||||||.|:|||::|||..|...|:.:..|.:.:......:..|.|
Zfish   569 RFLLEACKVNPAPKDRWGNTPMDEAKHFGHQEVQALLQEFNSKYNPTINPVADKETTEK 627

Known Domains:


GeneSequenceDomainRegion External IDIdentity
GLSNP_001163129.1 Glutaminase 223..513 CDD:282773 177/290 (61%)
Ank_4 538..589 CDD:290365 32/51 (63%)
ANK 540..>622 CDD:238125 50/82 (61%)
ANK repeat 540..566 CDD:293786 14/26 (54%)
ANK repeat 568..600 CDD:293786 21/32 (66%)
Ank_4 569..622 CDD:290365 33/53 (62%)
glsbXP_693171.3 Glutaminase 210..496 CDD:282773 177/290 (61%)
ANK 523..>606 CDD:238125 51/83 (61%)
Ank_4 523..572 CDD:290365 31/49 (63%)
ANK repeat 523..549 CDD:293786 14/26 (54%)
ANK repeat 551..583 CDD:293786 21/32 (66%)
Ank_4 553..605 CDD:290365 33/52 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C28851158
eggNOG 1 0.900 E1_COG2066
Hieranoid 1 1.000
Homologene 1 1.000 H22726
Inparanoid 1 1.050 587 1.000 Inparanoid score I937
OMA 1 1.010
OrthoDB 1 1.010 D175372at33208
OrthoFinder 1 1.000 FOG0001700
OrthoInspector 1 1.000 T596618
orthoMCL 1 0.900 OOG5_129245
Panther 1 1.100 O PTHR12544
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
1211.860

Return to query results.
Submit another query.