DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GLS and GLS

DIOPT Version :10

Sequence 1:NP_001163129.1 Gene:GLS / 36396 FlyBaseID:FBgn0261625 Length:775 Species:Drosophila melanogaster
Sequence 2:NP_055720.3 Gene:GLS / 2744 HGNCID:4331 Length:669 Species:Homo sapiens


Alignment Length:35 Identity:9/35 - (25%)
Similarity:14/35 - (40%) Gaps:2/35 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MRCSVCNYYSWSYFIAFGEIFISFHIARAFLHCAR 35
            |..|....|.:.|  .:..:|.|.|:.....:.||
Human    89 MSLSDIEIYGFDY--DYTLVFYSKHLHTLIFNAAR 121

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GLSNP_001163129.1 EF-hand_14 110..201 CDD:465587
Glutaminase 223..511 CDD:461499
Ank_2 540..622 CDD:463710
ANK repeat 540..566 CDD:293786
ANK repeat 568..600 CDD:293786
GLSNP_055720.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 68..118 7/28 (25%)
EF-hand_14 139..222 CDD:465587
Glutaminase 244..528 CDD:461499
Highly mobile activation loop. /evidence=ECO:0000250|UniProtKB:D3Z7P3 315..322
Ank_2 557..649 CDD:463710
ANK repeat 557..583 CDD:293786
ANK repeat 585..617 CDD:293786
ANK 1 585..614
ANK 2 619..648
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 647..669
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.