DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GLS and gls

DIOPT Version :8

Sequence 1:NP_001163129.1 Gene:GLS / 36396 FlyBaseID:FBgn0261625 Length:775 Species:Drosophila melanogaster
Sequence 2:XP_017952927.1 Gene:gls / 100379734 XenbaseID:XB-GENE-975800 Length:575 Species:Xenopus tropicalis

Alignment Length:556 Identity:292/557 (52%)
Similarity:391/557 (70%) Gaps:30/557 (5%)


  Fly   111 EDVLFDMFASEETGLISMGKFLAGLKTTGIRRNDPRVRELMDNLKKVHKLNNYETGSSAETQH-- 173
            ||:||...| |....|.:.||:..||.||:|.:|||::|.||.|:           .|.:|..  
 Frog    29 EDLLFYTIA-EGQEKIPVHKFITALKATGLRTSDPRLKECMDMLR-----------LSLQTMSDG 81

  Fly   174 --LNRETFKAVVAPNIVLIAKAFRQQFVIPDFTSFVKDIEDIYNRCKTNTLGKLADYIPQLARYN 236
              |::|.||..|..||||:.:|||::||||||.||...|:::|...:..:.||:||||||||:::
 Frog    82 VMLDKELFKKCVQSNIVLLTQAFRRKFVIPDFMSFTSHIDELYENARKLSGGKVADYIPQLAKFS 146

  Fly   237 PDSWGLSICTIDGQRFSIGDVDVPFTLQSCSKPLTYAIALEKLGPKVVHSYVGQEPSGRNFNELV 301
            ||.||:||||:||||.|:||..|||.||||.|||.||||:..|..:.||.|||:||||..||:|.
 Frog   147 PDLWGVSICTVDGQRHSVGDTKVPFCLQSCVKPLKYAIAVNDLSTEYVHRYVGKEPSGLRFNKLF 211

  Fly   302 LDQNKKPHNPMINAGAIL---------TCSLMNALV-----KPDMTSAEIFDYTMSWFKRLSGGE 352
            |::::||||||:|||||:         |.:|||..:     |...::||.|||.|.:|.:::|.|
 Frog   212 LNEDEKPHNPMVNAGAIVITSLIKAFGTFALMNKTIERGHRKQGSSNAEKFDYVMQFFNKMAGNE 276

  Fly   353 YIGFNNAVFLSEREAADRNYALGFYMRENKCFPKRTNLKEVMDFYFQCCSMETNCEAMSVIAASL 417
            |:||:||.|.||||:.|||:|:|:|::|.||||:.|::...:|||||.||:|..||:.||:||:|
 Frog   277 YVGFSNATFQSERESGDRNFAIGYYLKEKKCFPEHTDMVGTLDFYFQLCSIEVTCESASVMAATL 341

  Fly   418 ANGGICPTTEEKVFRPEVIRDVLSIMHSCGTYDYSGQFAFKVGLPAKSGVSGGMMLVIPNVMGIF 482
            ||||.||.|.|::..||.:|:.||:|||||.||:||||||.||||:|||||||::||:|||||:.
 Frog   342 ANGGFCPITGERILSPEAVRNTLSLMHSCGMYDFSGQFAFHVGLPSKSGVSGGILLVVPNVMGMM 406

  Fly   483 AWSPPLDHLGNTVRGLQFCEELVSMFNFHRYDNLKHLSNKKDPRKHRYETKGLSIVNLLFSAASG 547
            .||||||.|||:|||:|||::|||:.|||.||||:|.:.|.|||:...:.:..|::||||:|.:|
 Frog   407 CWSPPLDKLGNSVRGIQFCQDLVSLCNFHNYDNLRHFAKKLDPRREGGDQRVKSVINLLFAAYTG 471

  Fly   548 DVTALRRHRLSGMDITLADYDGRTALHLAASEGHLECVKFLLEQCHVPHNPKDRWGNLPVDEAEN 612
            ||:||||..|||||:...|||.|||||:|::|||:|.|:||||.|.|...|||||.|.|:|||.:
 Frog   472 DVSALRRFALSGMDMEQRDYDSRTALHVASAEGHVEVVRFLLEACKVNPFPKDRWNNTPMDEAMH 536

  Fly   613 FGHCHVVEFLRSWAEKADQSSEECKPEAVTSKTQAD 648
            |||..||:.|:.:........|.......|.:|..|
 Frog   537 FGHHDVVKILQEYQNNYKPLDEPNNGNDQTVQTNLD 572

Known Domains:


GeneSequenceDomainRegion External IDIdentity
GLSNP_001163129.1 Glutaminase 223..513 CDD:282773 180/304 (59%)
Ank_4 538..589 CDD:290365 33/51 (65%)
ANK 540..>622 CDD:238125 51/82 (62%)
ANK repeat 540..566 CDD:293786 16/26 (62%)
ANK repeat 568..600 CDD:293786 20/32 (63%)
Ank_4 569..622 CDD:290365 32/53 (60%)
glsXP_017952927.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 H22726
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D175372at33208
OrthoFinder 1 1.000 FOG0001700
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.