DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GLS and si:dkey-102c8.2

DIOPT Version :8

Sequence 1:NP_001163129.1 Gene:GLS / 36396 FlyBaseID:FBgn0261625 Length:775 Species:Drosophila melanogaster
Sequence 2:XP_021325366.1 Gene:si:dkey-102c8.2 / 100034425 ZFINID:ZDB-GENE-050208-329 Length:230 Species:Danio rerio

Alignment Length:110 Identity:23/111 (21%)
Similarity:41/111 (37%) Gaps:23/111 (21%)


  Fly    90 STPKTKEDNAKLHREQEQRNAEDVLFDMFASEETGLISMGK----FLAGLKTTGIRRNDPR---- 146
            |...|:.|:..|:.:..:....|.:..||..:||.:..:.|    .....:|.|.|....|    
Zfish    32 SVSVTEGDSVTLNTDVTEVQKTDQILWMFGPQETRIAEIHKQSIDMFDSNETFGDRLKMDRQTGS 96

  Fly   147 --VRELMDNLKKVHKLNNYETGSSAETQHLNRETFK----AVVAP 185
              :.::...|..::||....:|.:         |:|    .|.||
Zfish    97 LTITDITTELSGLYKLTIITSGGT---------TYKRFSVTVYAP 132

Known Domains:


GeneSequenceDomainRegion External IDIdentity
GLSNP_001163129.1 Glutaminase 223..513 CDD:282773
Ank_4 538..589 CDD:290365
ANK 540..>622 CDD:238125
ANK repeat 540..566 CDD:293786
ANK repeat 568..600 CDD:293786
Ank_4 569..622 CDD:290365
si:dkey-102c8.2XP_021325366.1 Ig 35..130 CDD:325142 20/104 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR12544
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.