DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: spt4 and SPT42

Sequence 1:NP_610802.1 Gene:spt4 FlyBaseID:FBgn0028683 Length:116 Species:Drosophila melanogaster
Sequence 2:NP_568976.1 Gene:SPT42 AraportID:AT5G63670 Length:116 Species:Arabidopsis thaliana

Alignment Length:83 Identity:38/84 (45%)
Similarity:57/84 (68%) Gaps:1/84 (1%)


  Fly    13 LRACLVCSLVKSFDQFETDGCENCEEFLRMKNNKDNVYDHTSNNFDGIIALTTPTDSWVAKWQRL 77
            |||||.|.|||::|||...||||| .|.:|:.:.:.:.:.|:.||:|||::..|:.||.|:|.|:
plant    16 LRACLRCRLVKTYDQFRDAGCENC-PFFKMEEDHERIVEVTTPNFNGIISVMDPSRSWAARWLRI 79

  Fly    78 SRFTRGIYAISVSGTLPQ 95
            .:|..|.|.::||..||:
plant    80 GKFAPGCYTLAVSEPLPE 97

Known Domains:


GeneSequenceDomainRegion External IDIdentity
spt4NP_610802.1 Spt4 11..108 CDD:153422 38/84 (45%)
SPT42NP_568976.1 Spt4 14..110 CDD:153422 38/84 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 88 1.000 Inparanoid score I2231
OMA 1 1.010
OrthoDB 1 1.010 D1617752at2759
OrthoInspector 1 1.000 T125404
orthoMCL 1 0.900 OOG5_128605
Panther 1 1.100 O PTHR12882
Phylome 1 0.910 0.667 Consistency score
87.980

Return to query results.
Submit another query.