DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: spt4 and AT5G08565

Sequence 1:NP_610802.1 Gene:spt4 FlyBaseID:FBgn0028683 Length:116 Species:Drosophila melanogaster
Sequence 2:NP_001190264.1 Gene:AT5G08565 AraportID:AT5G08565 Length:116 Species:Arabidopsis thaliana

Alignment Length:94 Identity:31/95 (33%)
Similarity:49/95 (52%) Gaps:23/95 (24%)


  Fly    13 LRACLVCSLVKSFDQFETDGCENCEEFLRMKNNKDNVYDHTSNNFDGIIA-----------LTTP 66
            |||||.|.|||::|||...||||| .|.:::::.:.:.|.|:.||:|.::           :..|
plant    16 LRACLRCRLVKTYDQFRDSGCENC-PFFKIEDDHERIVDVTTPNFNGFVSDRREINLTHCNILFP 79

  Fly    67 TDSWVAKWQRLSRFTRGIYAISVSGTLPQ 95
                       .:|..|.|.::||..||:
plant    80 -----------GKFAPGCYTLAVSEALPE 97

Known Domains:


GeneSequenceDomainRegion External IDIdentity
spt4NP_610802.1 Spt4 11..108 CDD:153422 31/95 (33%)
AT5G08565NP_001190264.1 Spt4 14..110 CDD:153422 31/95 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 88 1.000 Inparanoid score I2231
OMA 1 1.010
OrthoDB 1 1.010 D1617752at2759
OrthoInspector 1 1.000 T125404
orthoMCL 1 0.900 OOG5_128605
Panther 1 1.100 LDO PTHR12882
Phylome 1 0.910 0.667 Consistency score
87.980

Return to query results.
Submit another query.