DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: spt4 and SUPT4H1

Sequence 1:NP_610802.1 Gene:spt4 FlyBaseID:FBgn0028683 Length:116 Species:Drosophila melanogaster
Sequence 2:NP_003159.1 Gene:SUPT4H1 HGNCID:11467 Length:117 Species:Homo sapiens

Alignment Length:112 Identity:70/113 (62%)
Similarity:94/113 (83%) Gaps:0/113 (0%)


  Fly     1 MAFDAIPKDLRGLRACLVCSLVKSFDQFETDGCENCEEFLRMKNNKDNVYDHTSNNFDGIIALTT 65
            ||.:.:|||||.|||||:|||||:.||||.|||:||:.:|:||.|::.|||.||::||||||:.:
Human     1 MALETVPKDLRHLRACLLCSLVKTIDQFEYDGCDNCDAYLQMKGNREMVYDCTSSSFDGIIAMMS 65

  Fly    66 PTDSWVAKWQRLSRFTRGIYAISVSGTLPQSTLRDMKNRGIVYKSRD 112
            |.||||:||||:|.|..|:||:||:|.|||..:|::|:||:.|||||
Human    66 PEDSWVSKWQRVSNFKPGVYAVSVTGRLPQGIVRELKSRGVAYKSRD 112

Known Domains:


GeneSequenceDomainRegion External IDIdentity
spt4NP_610802.1 Spt4 11..108 CDD:153422 59/97 (61%)
SUPT4H1NP_003159.1 Interaction with SUPT5H 2..40 25/38 (66%)
Spt4 11..108 CDD:153422 59/97 (61%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C251761504
eggNOG 1 0.900 E1_COG5204
Hieranoid 1 1.000
Homologene 1 1.000 H68303
Inparanoid 1 1.050 163 1.000 Inparanoid score I4147
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D1617752at2759
OrthoFinder 1 1.000 FOG0003204
OrthoInspector 1 1.000 T1073510
orthoMCL 1 0.900 OOG5_128605
Panther 1 1.100 LDO PTHR12882
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1386
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
1413.800

Return to query results.
Submit another query.