DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sin3A and sin3a

DIOPT Version :8

Sequence 1:NP_001246282.1 Gene:Sin3A / 36382 FlyBaseID:FBgn0022764 Length:2066 Species:Drosophila melanogaster
Sequence 2:XP_002937523.2 Gene:sin3a / 100495645 XenbaseID:XB-GENE-480875 Length:1275 Species:Xenopus tropicalis

Alignment Length:1832 Identity:634/1833 (35%)
Similarity:803/1833 (44%) Gaps:649/1833 (35%)


  Fly   194 TVSSSSQTGTIRQRTISGTQTVATAVGNLATISQQQPVQQSPLGKA---QTPPSSVVANSIPVGG 255
            :|:...|..|:.|.:....|...|||......|...|....|..::   .|||::          
 Frog    54 SVAPGYQVSTVPQSSGGHGQASLTAVHGSHHHSTPVPSHGGPAVQSHAHSTPPAA---------- 108

  Fly   256 TTPPQGQSGNATPRLKVEDALSYLDQVKYQYADQPQIYNNFLDIMKEFKSHCIDTPGVIERVSTL 320
              |.|||.   ..|||||||||||||||.|:..|||:||:||||||||||..|||||||.|||.|
 Frog   109 --PAQGQQ---FQRLKVEDALSYLDQVKLQFGSQPQVYNDFLDIMKEFKSQSIDTPGVISRVSQL 168

  Fly   321 FKGHTELIYGFNMFLPPGYKIEIHSDALGCSVPVVSMPSPPGAPTSTGTVHMLTGNSSMSGAGHI 385
            ||||.|||.|||.|||||||||:.::.|      |::.:|       |.||.:|           
 Frog   169 FKGHPELIMGFNTFLPPGYKIEVQTNDL------VNVTTP-------GQVHQIT----------- 209

  Fly   386 AIKTTNAATLTPAAGAGAAAAAAAVAQIQSAGAVNLMTHGGASLTQTTIHALQQATPPQSQSPGG 450
                                                 |||           ||   ||..|:|  
 Frog   210 -------------------------------------THG-----------LQ---PPVPQAP-- 221

  Fly   451 GHVHVSVTNSTAANAVVPGQPG---ISVSAHNVPQ----NYSRDRERATITPTGQVAGAAANVNA 508
                            .|.||.   |....|..||    ..|:..:....|||.|         .
 Frog   222 ----------------PPSQPSAQPIPSPVHPTPQPPPAKISKPMQSQAHTPTNQ---------Q 261

  Fly   509 SASIVVGGPPTPNSLSELSPHGG---AGGGPGAGAAQHNLHHIQQAHQSILLGETGQQNQPVEFN 570
            |..|....|.:|.:    .||..   |...|.|.||.                .|.|.|||||||
 Frog   262 STPIQYPSPRSPPA----QPHTPGPLAHATPTATAAT----------------PTMQNNQPVEFN 306

  Fly   571 HAITYVNKIKNRFQNQPAKYKKFLEILHDYQREQKVMKEGSLNQGKMLTEQEVYTQVAKLFGQDE 635
            |||.||||||||||.||..||.||||||.||:||:..||...|....|||||||.|||:||...|
 Frog   307 HAINYVNKIKNRFQGQPDIYKSFLEILHTYQKEQRNAKEAGGNYTPALTEQEVYAQVARLFKNQE 371

  Fly   636 DLLREFGQFLPDATNHQSGQYMSKSA-----SVHNDHGKRPTATLSGGAHITMSSASPAPSGSPL 695
            |||.|||||||||   .|...:||:.     ||.||||                           
 Frog   372 DLLSEFGQFLPDA---NSSVLLSKTTAEKVESVRNDHG--------------------------- 406

  Fly   696 HLGATTLPQIDKSAHAAAIGNLSAVNTSVSIKTYNNNQQQQNHVIGSGLNATRNDILFEKDYHAG 760
              |....||:                         ||:||:                        
 Frog   407 --GTVKKPQL-------------------------NNKQQR------------------------ 420

  Fly   761 LQQQAHQRGAGVGGHHHLAGTAAGANIGRPGVGASVMVSYDKEHRNNHHVQKYVGHAPNQNLTHG 825
                                                                     ||||    
 Frog   421 ---------------------------------------------------------PNQN---- 424

  Fly   826 HNAKKSPSYGIPSVIGSMPHISDNSLDRSSPGISYATPPLPSGPHGQHNSGSATRRPGDDSLVGH 890
                                                              |...||        |
 Frog   425 --------------------------------------------------GCQIRR--------H 431

  Fly   891 YASGAPPAKRPKPYC---RDVSFSEASSKCTISDAAFFDKVRKALRSPEVYDNFLRCLTLFNQEI 952
            ..:|..|..:.||..   :|.|.::|:.....:::.|||||||||||.|.||||||||.:||||:
 Frog   432 SGTGVTPPVKKKPKILIPKDQSLADANKHGAGAESQFFDKVRKALRSGEAYDNFLRCLVIFNQEV 496

  Fly   953 VSKTELLGLVSPFLMKFPDLLRWFTDFLGPPSGQPAGGLIDGMPLAATQRQGGGSSNSSHDRGTS 1017
            :|::||:.||||||.|||:|..||.:||                         |...|||.....
 Frog   497 ISRSELVQLVSPFLAKFPELFTWFKNFL-------------------------GYKESSHLESFP 536

  Fly  1018 HQSAAEYV-QDVDLSSCKRLGASYCALPQSTVPKKCSGRTALCREVLNDKWVSFPTWASEDSTFV 1081
            .:.|.|.: .::|.:||||||:||.|||:|....||:|||.||:|||||.|||||:| |||||||
 Frog   537 KERATEGIAMEIDYASCKRLGSSYRALPKSFQQPKCTGRTPLCKEVLNDTWVSFPSW-SEDSTFV 600

  Fly  1082 TSRKTQFEETIYRNIHRTEDERFELDLVIEVNSATIRVLENLQKKMSRMSTEELSKFHLDDHLGG 1146
            :|:|||:||.||    |.||||||||:|:|.|.|||||||.:|||:||:|.|:.:||.||:.|||
 Frog   601 SSKKTQYEEHIY----RCEDERFELDVVLETNLATIRVLETIQKKLSRLSAEDQAKFRLDNTLGG 661

  Fly  1147 TSQTIHQRAIHRIYGDKSGEIITGMKKNPFVAVPIVLKRLKVKEEEWREAQKTFNKQWREQNEKY 1211
            ||:.||::|:.|||.||:.:||.|:||||.|||||||||||:|||||||||:.|||.||||||||
 Frog   662 TSEVIHRKALQRIYADKAADIIDGLKKNPAVAVPIVLKRLKMKEEEWREAQRGFNKIWREQNEKY 726

  Fly  1212 YLKSLDHQAINFKPNDMKALRSKSLFNEIETLYDERHDQ--EDDAMEPFGPHLVLPYKDKTILDD 1274
            ||||||||.||:|..|.|.||||||.||||::||||.:|  ||::....||||.|.|.||.||:|
 Frog   727 YLKSLDHQGINYKQIDTKVLRSKSLLNEIESIYDERQEQASEDNSGISSGPHLTLTYDDKQILED 791

  Fly  1275 AANLLIHHVKRQTGIQKQEKQKIKQIIRQFVPDLFFAPRQPLSDDERDDAFPFLVDDNTKMDVDS 1339
            ||:|:||||||||||||::|.|||||:..|:|||.|:.|..|||.|.::                
 Frog   792 AASLIIHHVKRQTGIQKEDKYKIKQIVYHFIPDLLFSQRGELSDVEEEE---------------- 840

  Fly  1340 PLGRTESSTRNAKSTPSESASPARSNASTSSVTPAGIKKETDDSKATTGSFAPASSATASSATPV 1404
                 |..|                             .||:|                      
 Frog   841 -----EEET-----------------------------AETED---------------------- 849

  Fly  1405 DDATPSTSSAAAAASAASSSTVSGTEGKPKDDPLSSHKEEGAGSTSSGVATSPRQAQDTAGAGVD 1469
                                      |..|       |..|.|   .|..:||.:|         
 Frog   850 --------------------------GVTK-------KHNGVG---VGGGSSPPKA--------- 869

  Fly  1470 VEIKLEHPADFSNPKLLPPHAHGQR---EDESYTLFFANNNWYLFLRLHAILCDRLHVMYERARL 1531
                          ||:..:...|:   .:::|.||:.|||||:|||||.|||.||..:|.:|..
 Frog   870 --------------KLMFGNTAAQKWRGVEDAYNLFYVNNNWYIFLRLHQILCSRLLRIYNQAEK 920

  Fly  1532 LAIEEERCRVNRRE----------STATALRLKPKPEIQVEDYYPTFLDMLKNVLDGNMDSNTFE 1586
            ...||.|.|...||          |.|..||||...:|:.|||||.||||::|:||||||||.:|
 Frog   921 QVEEEMREREWEREVLGLKRDKNDSPAIQLRLKEPMDIEAEDYYPAFLDMVRNLLDGNMDSNQYE 985

  Fly  1587 DTMREMFGIYAYISFTLDKVVSNAVRQLQYCVTERAALDCVELFATEQRRGCTGGFCRDAHKTFD 1651
            |::||||.|:|:|:||:||::.:.|||||:.|::...:...||:.:|.....|||..........
 Frog   986 DSLREMFTIHAFIAFTMDKLIQSIVRQLQHIVSDEICVQVTELYLSESSSNATGGLLTTQASRNL 1050

  Fly  1652 REMSYQRKAESILNEENCFKVYIYKI--DCRVTIELLDSEPEEVDKPAALKAQKFSKYVERLANP 1714
            .|.:||||||.::::|||||:...:.  ..::||||||:|.|..|.||  :.:::|.|:||..| 
 Frog  1051 NEANYQRKAEQLMSDENCFKLMFSQSRGQVQLTIELLDTEEENSDDPA--ETERWSDYIERYMN- 1112

  Fly  1715 ALGGGGNTGRSDSALGNDSVVDGSDIKTEADEDTAELRYREGGIGGAGKARFLVRNKRRSKLLEE 1779
                                         .|..:.|||...     |.|..||.||.||      
 Frog  1113 -----------------------------CDSTSPELREHL-----AQKPVFLPRNLRR------ 1137

  Fly  1780 QVRQLFEHRRNRIEQHGTAASLEPISVDSAISSNSTTGGGGSGTNNNNNNNNNNNSWGGKRLERL 1844
             :|:.   :|.|.:|.                      ..|||.....|            ||.|
 Frog  1138 -IRKC---QRGREQQE----------------------KDGSGKRALEN------------LESL 1164

  Fly  1845 GAPQVGLAEQYAFNDRDEISTNISNGRCFVTSKNLKLLKYDAVRRAKKSHCRVTQAKYAHFQTYV 1909
            ...|.    ::..|         |....:|......:.:..|:.||::||.||::..:..||:::
 Frog  1165 DKLQC----KFKLN---------SYKMVYVIKSEDYMYRRTALLRAQQSHERVSKRLHQRFQSWL 1216

  Fly  1910 NKWLQQHVSEQQQQNCVDWLLGKTADQINASGWGSASKTKTVQQKDTSKTPYRIYNRYRVVQSAV 1974
            .||..:|||.:.......||:|:          |..........:|.....:...|:|||     
 Frog  1217 RKWNLEHVSHEMASETRKWLMGE----------GVEGMVPCTTSRDCEILHFVDINKYRV----- 1266

  Fly  1975 SGGLMSATAPTP 1986
               ...||..||
 Frog  1267 ---KYGATFKTP 1275

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Sin3ANP_001246282.1 Sin3 238..1719 CDD:227889 569/1520 (37%)
PAH 291..335 CDD:280780 35/44 (80%)
PAH 588..645 CDD:280780 36/57 (63%)
PAH 936..980 CDD:280780 29/44 (66%)
Sin3_corepress 1034..1133 CDD:285494 68/99 (69%)
Sin3a_C 1502..>1710 CDD:293484 100/220 (45%)
sin3aXP_002937523.2 Sin3 99..1216 CDD:227889 605/1709 (35%)
PAH 139..183 CDD:280780 35/44 (80%)
PAH 324..381 CDD:280780 36/57 (63%)
PAH 480..524 CDD:280780 29/44 (66%)
Sin3_corepress 554..648 CDD:285494 68/99 (69%)
Sin3a_C 891..1188 CDD:293484 129/391 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C112767360
eggNOG 1 0.900 E1_COG5602
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 H32124
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D198862at33208
OrthoFinder 1 1.000 FOG0001148
OrthoInspector 00.000 Not matched by this tool.
Phylome 1 0.910 0.800 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
76.710

Return to query results.
Submit another query.