DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Ak6 and ak6

Sequence 1:NP_610797.1 Gene:Ak6 FlyBaseID:FBgn0033754 Length:175 Species:Drosophila melanogaster
Sequence 2:NP_001017167.1 Gene:ak6 XenbaseID:XB-GENE-972292 Length:171 Species:Xenopus tropicalis

Alignment Length:163 Identity:85/164 (52%)
Similarity:113/164 (69%) Gaps:0/164 (0%)


  Fly    10 PNILITGTPGAGKSYLCERIASELKFEWLDCSKIAKEKNFVEEYDEEYDCPILDEEKLMDHLEPL 74
            ||||:|||||.||:.|.:.::|....|:::...:|||.|..|.||||||||||||::::|.||..
 Frog     4 PNILLTGTPGVGKTTLGKELSSRTGLEYINVGDLAKEGNLYEGYDEEYDCPILDEDRVVDELEDK 68

  Fly    75 MAKGGNVVEYHGCDFFPERWFQAVFVVTCPNTTLYDRLKERNYNEKKLASNIQCEIFGTILEEAR 139
            |.:||.:::||||||||||||..|||:...|..||:||:.|.|.||||..|||||||.||.|||.
 Frog    69 MTEGGVILDYHGCDFFPERWFNIVFVLRTDNGLLYERLESRGYKEKKLQDNIQCEIFQTIYEEAA 133

  Fly   140 DSYKSDIVFELKGETKADAHISIKTVKNWYRMW 172
            :||:.:||.:|...|..|...:|:.:..|.:.|
 Frog   134 ESYQKEIVHQLPSNTPEDLEQNIEQIIQWIQQW 166

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Ak6NP_610797.1 Fap7 10..173 CDD:224847 85/164 (52%)
ak6NP_001017167.1 AroK 2..151 CDD:223775 81/147 (55%)
Fap7 4..151 CDD:224847 81/147 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C264036282
eggNOG 1 0.900 E1_COG1936
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 H5540
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D1488235at2759
OrthoFinder 1 1.000 FOG0004538
OrthoInspector 00.000 Not matched by this tool.
Phylome 1 0.910 0.952 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
87.720

Return to query results.
Submit another query.