DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ak6 and ak6

DIOPT Version :9

Sequence 1:NP_610797.1 Gene:Ak6 / 36379 FlyBaseID:FBgn0033754 Length:175 Species:Drosophila melanogaster
Sequence 2:NP_001017167.1 Gene:ak6 / 549921 XenbaseID:XB-GENE-972292 Length:171 Species:Xenopus tropicalis


Alignment Length:163 Identity:85/163 - (52%)
Similarity:113/163 - (69%) Gaps:0/163 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 PNILITGTPGAGKSYLCERIASELKFEWLDCSKIAKEKNFVEEYDEEYDCPILDEEKLMDHLEPL 74
            ||||:|||||.||:.|.:.::|....|:::...:|||.|..|.||||||||||||::::|.||..
 Frog     4 PNILLTGTPGVGKTTLGKELSSRTGLEYINVGDLAKEGNLYEGYDEEYDCPILDEDRVVDELEDK 68

  Fly    75 MAKGGNVVEYHGCDFFPERWFQAVFVVTCPNTTLYDRLKERNYNEKKLASNIQCEIFGTILEEAR 139
            |.:||.:::||||||||||||..|||:...|..||:||:.|.|.||||..|||||||.||.|||.
 Frog    69 MTEGGVILDYHGCDFFPERWFNIVFVLRTDNGLLYERLESRGYKEKKLQDNIQCEIFQTIYEEAA 133

  Fly   140 DSYKSDIVFELKGETKADAHISIKTVKNWYRMW 172
            :||:.:||.:|...|..|...:|:.:..|.:.|
 Frog   134 ESYQKEIVHQLPSNTPEDLEQNIEQIIQWIQQW 166

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ak6NP_610797.1 Fap7 10..173 CDD:224847 85/163 (52%)
ak6NP_001017167.1 Fap7 4..151 CDD:224847 81/146 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 144 1.000 Domainoid score I4583
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H5540
Inparanoid 1 1.050 175 1.000 Inparanoid score I3948
OMA 1 1.010 - - QHG62155
OrthoDB 1 1.010 - - D1488235at2759
OrthoFinder 1 1.000 - - FOG0005161
OrthoInspector 1 1.000 - - oto103997
Panther 1 1.100 - - LDO PTHR12595
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R631
SonicParanoid 1 1.000 - - X3679
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1212.110

Return to query results.
Submit another query.