DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Ak6 and zgc:86811

Sequence 1:NP_610797.1 Gene:Ak6 FlyBaseID:FBgn0033754 Length:175 Species:Drosophila melanogaster
Sequence 2:NP_001002118.1 Gene:zgc:86811 ZFINID:ZDB-GENE-040625-113 Length:171 Species:Danio rerio

Alignment Length:166 Identity:77/167 (46%)
Similarity:109/167 (65%) Gaps:0/167 (0%)


  Fly     9 KPNILITGTPGAGKSYLCERIASELKFEWLDCSKIAKEKNFVEEYDEEYDCPILDEEKLMDHLEP 73
            :||||:|||||.||:.|.:.:|......:::...:|:|....:.:||||.||||||::::|.||.
Zfish     3 RPNILLTGTPGVGKTTLGKELAQRTGLTYVNVGDLAQEAELFDGFDEEYQCPILDEDRVVDELED 67

  Fly    74 LMAKGGNVVEYHGCDFFPERWFQAVFVVTCPNTTLYDRLKERNYNEKKLASNIQCEIFGTILEEA 138
            .|..||.:::||||||||||||..|||:...||.||:||:.|.|..|||..|:|||||.||.|||
Zfish    68 QMGDGGVIIDYHGCDFFPERWFHIVFVLRTDNTNLYNRLESRGYTGKKLQDNVQCEIFQTIFEEA 132

  Fly   139 RDSYKSDIVFELKGETKADAHISIKTVKNWYRMWKR 174
            .::||.:||.:|...|..|...:::.:..|...|.:
Zfish   133 VEAYKEEIVHQLPSNTPEDLERNLEQIVQWIEQWMK 168

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Ak6NP_610797.1 Fap7 10..173 CDD:224847 77/163 (47%)
zgc:86811NP_001002118.1 Fap7 4..169 CDD:224847 77/166 (46%)
AroK 4..168 CDD:223775 77/164 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C264036323
eggNOG 1 0.900 E1_COG1936
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 H5540
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D1488235at2759
OrthoFinder 1 1.000 FOG0004538
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_127564
Panther 1 1.100 LDO PTHR12595
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R631
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
109.840

Return to query results.
Submit another query.