DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Ak6 and Taf9

Sequence 1:NP_610797.1 Gene:Ak6 FlyBaseID:FBgn0033754 Length:175 Species:Drosophila melanogaster
Sequence 2:NP_001015889.1 Gene:Taf9 MGIID:1888697 Length:264 Species:Mus musculus

Alignment Length:108 Identity:23/109 (21%)
Similarity:37/109 (34%) Gaps:26/109 (24%)


  Fly    41 SKIAKEKNFVE----------EYDEEYDCPILDEEKL-MDHLEPLMAKGGNVVEYHGCDFFPERW 94
            ::|.|:....|          |:...|...|||:.|: ..|.:.......:|.....|     |.
Mouse    20 AQILKDMGITEYEPRVINQMLEFAFRYVTTILDDAKIYSSHAKKATVDADDVRLAIQC-----RA 79

  Fly    95 FQAVFVVTCPNTTLYDRLKERN---------YNEKKLASNIQC 128
            .|: |....|...|.|..::||         |:..:|..:..|
Mouse    80 DQS-FTSPPPRDFLLDIARQRNQTPLPLIKPYSGPRLPPDRYC 121

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Ak6NP_610797.1 Fap7 10..173 CDD:224847 23/109 (21%)
Taf9NP_001015889.1 TFIID-31kDa 9..129 CDD:280456 23/109 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG1936
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 T1083053
orthoMCL 1 0.900 OOG5_127564
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.969 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R631
TreeFam 1 0.960
87.710

Return to query results.
Submit another query.