DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Ak6 and Ak6

Sequence 1:NP_610797.1 Gene:Ak6 FlyBaseID:FBgn0033754 Length:175 Species:Drosophila melanogaster
Sequence 2:NP_081868.1 Gene:Ak6 MGIID:5510732 Length:172 Species:Mus musculus

Alignment Length:163 Identity:80/164 (49%)
Similarity:105/164 (64%) Gaps:0/164 (0%)


  Fly    10 PNILITGTPGAGKSYLCERIASELKFEWLDCSKIAKEKNFVEEYDEEYDCPILDEEKLMDHLEPL 74
            ||||:|||||.||:.|.:.:||....::::...:|:|....:.|||||.||||||::::|.||..
Mouse     4 PNILLTGTPGVGKTTLGKELASRSGLKYVNVGDLAREGQLYDGYDEEYGCPILDEDRVVDELEHQ 68

  Fly    75 MAKGGNVVEYHGCDFFPERWFQAVFVVTCPNTTLYDRLKERNYNEKKLASNIQCEIFGTILEEAR 139
            |.:||.:|:||||||||||||..|||:...|..||.||:.|.||||||..|||||||..:.|||.
Mouse    69 MQEGGVIVDYHGCDFFPERWFHIVFVLRTDNGVLYKRLETRGYNEKKLQDNIQCEIFQVLYEEAI 133

  Fly   140 DSYKSDIVFELKGETKADAHISIKTVKNWYRMW 172
            .|||.:||.:|..........:|..:..|...|
Mouse   134 ASYKEEIVHQLPSNEPEQLEDNINQISKWIEQW 166

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Ak6NP_610797.1 Fap7 10..173 CDD:224847 80/164 (49%)
Ak6NP_081868.1 Fap7 4..170 CDD:224847 80/164 (49%)
NMPbind. {ECO:0000255|HAMAP-Rule:MF_03173} 33..56 10/23 (43%)
LID. {ECO:0000255|HAMAP-Rule:MF_03173} 108..118 7/10 (70%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 H5540
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0004538
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR12595
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.110

Return to query results.
Submit another query.