DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cyp301a1 and Cyp12b2

Sequence 1:NP_610796.1 Gene:Cyp301a1 FlyBaseID:FBgn0033753 Length:553 Species:Drosophila melanogaster
Sequence 2:NP_611370.2 Gene:Cyp12b2 FlyBaseID:FBgn0034387 Length:535 Species:Drosophila melanogaster

Alignment Length:531 Identity:168/532 (32%)
Similarity:282/532 (53%) Gaps:35/532 (7%)


  Fly    37 RESSTG----VATCPHLADSEEASAPRIHSTSEWQNALPYNQIPGPKPIPILGNTWRLMPIIGQY 97
            |.||.|    ..|...||||      ||  ..:||.|..:.:||||..:.:|.   ..|| .|..
  Fly    22 RNSSVGGTLSQQTQLELADS------RI--DEKWQQARSFGEIPGPSLLRMLS---FFMP-GGAL 74

  Fly    98 TISDVAKISSLLHDRYGRIVRFGGLIGRPDLLFIYDADEIEKCYRSEGPTPFRPSMPSLVKYKSV 162
            ..:::.:::.|:.:.||.|....|::|:|:.:|.|:.|:.|..||:||..|.|..:.||..|:.:
  Fly    75 RNTNLIQMNRLMREMYGDIYCIPGMMGKPNAVFTYNPDDFEMTYRNEGVWPIRIGLESLNYYRKI 139

  Fly   163 VRKDFFGDLGGVVGVHGEPWREFRSRVQKPVLQLSTIRRYLQPLEVITEDFLVRCENLLD-ENQE 226
            .|.|.|..:||:....|:.|.:.|::|...::::..:|:.|..|:.|:::|:.:.|...: |...
  Fly   140 HRPDVFKGVGGLASDQGQEWADIRNKVNPVLMKVQNVRQNLPQLDQISKEFIDKLETQRNPETHT 204

  Fly   227 LPEDFDNEIHKWSLECIGRVALDTRLGCLESNLKPDSE--PQQIIDAAKYALRNVATLELKAPYW 289
            |..||.|::..|:.|.|..|||:||:|.|..|..|:::  .:.:.|...|:.:    .:::...|
  Fly   205 LTTDFHNQLKMWAFESISFVALNTRMGLLSDNPDPNADRLAKHMRDFFNYSFQ----FDVQPSIW 265

  Fly   290 RYFPTPLWTRYVKNMNFFVGVCMKYIQSATERLKTQDPSLRAGEPSLVEKVILSQKDEKIATIMA 354
            .::.|..:.:::|..:....:...||::|.......|.    |:...|.:.:| :.::|:|..|.
  Fly   266 TFYKTAGFKKFLKTYDNITDITSNYIETAMRGFGKNDD----GKTKCVLEQLL-EHNKKVAVTMV 325

  Fly   355 LDLILVGIDTISMAVCSMLYQLATRPVDQQKVHEELKRLLPDPNTPLTIPLLDQMHHLKGFIKEV 419
            :|:::.||||.|.|..::||.||..|..|:|:..||.|:||.....||......|.:|:..|||.
  Fly   326 MDMLMAGIDTTSSACLTILYHLARNPSKQEKLRRELLRILPTTKDSLTDQNTKNMPYLRACIKEG 390

  Fly   420 FRMYSTVIGNGRTLMEDSVICGYQVPKGVQAVFPTIVTGNMEEYVTDAATFRPERWLK----PQH 480
            .|:.|...||.|...:|.|:.|||||:|...:...:...|.::|...::.|.||||||    |..
  Fly   391 LRITSITPGNFRITPKDLVLSGYQVPRGTGVLMGVLELSNDDKYFAQSSEFIPERWLKSDLAPDI 455

  Fly   481 GGTPG--KLHPFASLPYGYGARMCLGRRFADLEMQILLAKLLRNYKLEY-NHKPLDYAVTFMYAP 542
            ...|.  ..:||..||:|:|.|.|:|:|.|:||::.||.:|||:||:.: ...|::|..|.:.:|
  Fly   456 QACPAARTRNPFVYLPFGFGPRTCIGKRIAELEIETLLVRLLRSYKVSWLPETPIEYESTIILSP 520

  Fly   543 DGPLRFKMTRV 553
            .|.:|||:..|
  Fly   521 CGDIRFKLEPV 531

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cyp301a1NP_610796.1 p450 76..530 CDD:299894 144/464 (31%)
Cyp12b2NP_611370.2 p450 59..511 CDD:299894 143/465 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0159
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 217 1.000 Inparanoid score I2276
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D185685at33208
OrthoFinder 1 1.000 FOG0001319
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR24305
RoundUp 00.000 Not matched by this tool.
55.060

Return to query results.
Submit another query.