DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Lac and klg

Sequence 1:NP_523713.2 Gene:Lac FlyBaseID:FBgn0010238 Length:359 Species:Drosophila melanogaster
Sequence 2:NP_524454.2 Gene:klg FlyBaseID:FBgn0017590 Length:545 Species:Drosophila melanogaster

Alignment Length:294 Identity:70/295 (24%)
Similarity:126/295 (43%) Gaps:49/295 (17%)


  Fly    42 IGGTVEFDCSVQYAKEYNVLFLKTDSDPVFLSTGSTLVIKDSRFSLRYDPNSSTYKLQIKDIQET 106
            :|.|:...|.|:....:.:|:.:..:   .|:..:.:|.:|.|..|     ...|.|:|.|::..
  Fly   114 VGDTLVLPCQVENLGNFVLLWRRGTN---VLTASNIMVTRDERVRL-----IDGYNLEISDLEPQ 170

  Fly   107 DAGTYTCQVV----ISTVHKVSAEVKLSVRRPPVISDNSTQSVVASEGSEVQMECYASGYPTPTI 167
            |||.|.||:.    ...||.|...|..|||..|     ::..:.|.:|..:.:||..||.|.|:|
  Fly   171 DAGDYVCQISDKINRDQVHTVEILV
PPSVRAIP-----TSGQLQARKGGPITLECKGSGNPVPSI 230

  Fly   168 TWRRENNAILPTDSATYVGN--TLRIKSVKKEDRGTYYCVADNGVSKGDRRNINVEVEFAPVITV 230
            .|.:::.|   ..|...:|:  .|.::.::::..|.|.|.|||||......::.::|.:.|.|.|
  Fly   231 YWTKKSGA---NKSTARIGDGPILTLEKLERQQAGVYQCTADNGVGD
PVTVDMRLDVLYPPDIQV 292

  Fly   231 PRPRLGQALQYDMDLECHIEAYPPPAIVWTKDDIQL-----------ANNQHYSISHFATADEYT 284
            .:..:.....::..|.|.:.|.|...:.|.::...:           ||....:|.|        
  Fly   293 EKSWIHSGEGFEAKLVCIVFADPVATVSWYQNSFPIQSTDRRIMATRANRHMLTIRH-------- 349

  Fly   285 DSTLRVITVEKRQYGDYVCKATNRFGEAEARVNL 318
                    :::..:|:|.|.|.|..|.:...:.|
  Fly   350 --------IQQEDFGNYSCVADNSLGRSRKYMEL 375

Known Domains:


GeneSequenceDomainRegion External IDIdentity
LacNP_523713.2 IG_like 36..131 CDD:214653 25/93 (27%)
V-set 43..132 CDD:284989 26/93 (28%)
IG_like 143..222 CDD:214653 22/81 (27%)
IGc2 149..211 CDD:197706 21/64 (33%)
I-set 227..318 CDD:254352 17/102 (17%)
IGc2 236..310 CDD:197706 14/85 (16%)
klgNP_524454.2 DUF1370 63..>124 CDD:284518 3/10 (30%)
IG_like 109..195 CDD:214653 23/89 (26%)
Ig 118..191 CDD:143165 20/81 (25%)
IG_like 205..274 CDD:214653 22/72 (31%)
IGc2 213..273 CDD:197706 21/63 (33%)
IGc2 301..367 CDD:197706 14/82 (17%)
FN3 392..486 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C80450449
eggNOG 1 0.900 E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000159
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
32.830

Return to query results.
Submit another query.