powered by:
Protein Alignment Cpr49Ah and Cpr65Au
DIOPT Version :8
Sequence 1: | NP_610777.1 |
Gene: | Cpr49Ah / 36354 |
FlyBaseID: | FBgn0033731 |
Length: | 190 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001286953.1 |
Gene: | Cpr65Au / 59158 |
FlyBaseID: | FBgn0042119 |
Length: | 106 |
Species: | Drosophila melanogaster |
Alignment Length: | 69 |
Identity: | 25/69 - (36%) |
Similarity: | 34/69 - (49%) |
Gaps: | 1/69 - (1%) |
Fly 54 IKYNKEQSDDGSYKTEYETGNSIIHEETGFLKDFDTNPNGVLVQHGQYSYQSPEGTLVNVQYTAD 118
||...|.:.| .|...|||.|.|...|||.:|......:|.|...|..|:.:|:|....:.:|||
Fly 31 IKLESENTGD-KYSFAYETSNGISRTETGEVKPGAGEEDGSLSVQGSTSWSAPDGKKYEISFTAD 94
Fly 119 ENGF 122
|.|:
Fly 95 ETGY 98
|
Known Domains:
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
|
|
|
E1_2EQ63 |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
|
|
P |
PTHR10380 |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
User_Submission |
0 | 0.000 |
Not matched by this tool. |
|
2 | 2.000 |
|
Return to query results.
Submit another query.