DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr49Ah and Cpr65Ax1

DIOPT Version :8

Sequence 1:NP_610777.1 Gene:Cpr49Ah / 36354 FlyBaseID:FBgn0033731 Length:190 Species:Drosophila melanogaster
Sequence 2:NP_001097523.1 Gene:Cpr65Ax1 / 5740751 FlyBaseID:FBgn0086900 Length:102 Species:Drosophila melanogaster

Alignment Length:84 Identity:29/84 - (34%)
Similarity:41/84 - (48%) Gaps:3/84 - (3%)


  Fly    52 PIIKYNKEQSDDG--SYKTEYETGNSIIHEETGFLKDFDTNPNGVLVQHGQYSYQSPEGTLVNVQ 114
            |.::..:..|:.|  :|....||.:.....|.|.||:..|....:.. ||.:||..|:|....|.
  Fly    18 PTVEVLRSDSNVGIDNYSYAVETSDGTSKSEEGVLKNAGTELEAIST-HGSFSYVGPDGQTYTVT 81

  Fly   115 YTADENGFRATGDHIPTPP 133
            |.||||||:..|.|:|..|
  Fly    82 YVADENGFQPQGAHLPVAP 100

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cpr49AhNP_610777.1 Chitin_bind_4 66..122 CDD:278791 20/55 (36%)
Cpr65Ax1NP_001097523.1 Chitin_bind_4 34..89 CDD:278791 20/55 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_2EQ63
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.