powered by:
Protein Alignment Cpr49Ah and Cpr65Eb
DIOPT Version :9
| Sequence 1: | NP_610777.1 |
Gene: | Cpr49Ah / 36354 |
FlyBaseID: | FBgn0033731 |
Length: | 190 |
Species: | Drosophila melanogaster |
| Sequence 2: | NP_648076.3 |
Gene: | Cpr65Eb / 38774 |
FlyBaseID: | FBgn0035736 |
Length: | 179 |
Species: | Drosophila melanogaster |
| Alignment Length: | 111 |
Identity: | 41/111 - (36%) |
| Similarity: | 57/111 - (51%) |
Gaps: | 19/111 - (17%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 34 DKPDHHRHEDHRETSTWIPIIKYNKEQSDDGSYKTEYETGNSIIHEETGFLKDFDTNPNGVLVQH 98
|.|| .|.|..::: |:.:.:||.|..::||.|.|..:|.|. |.....
Fly 24 DSPD-----AHAEIRSFV-----NELKQEDGIYNYQFETSNGIAQQEQGV---------GGYYAS 69
Fly 99 GQYSYQSPEGTLVNVQYTADENGFRATGDHIPTPPAIPEEIQKGLD 144
|...|.:|||.|:.:.||||||||:..|:|:|||..|||.|.|.|:
Fly 70 GSSQYYTPEGQLIQLTYTADENGFQPQGEHLPTPHPIPEAILKSLE 115
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
| Tool |
Simple Score |
Weighted Score |
Original Tool Information |
| BLAST Result |
Score |
Score Type |
Cluster ID |
| Compara |
0 | 0.000 |
Not matched by this tool. |
| Domainoid |
0 | 0.000 |
Not matched by this tool. |
| eggNOG |
1 |
0.900 |
- |
- |
|
E1_2EQ63 |
| Homologene |
0 | 0.000 |
Not matched by this tool. |
| Inparanoid |
0 | 0.000 |
Not matched by this tool. |
| Isobase |
0 | 0.000 |
Not matched by this tool. |
| OMA |
0 | 0.000 |
Not matched by this tool. |
| OrthoDB |
1 |
1.010 |
- |
- |
|
D1459720at2759 |
| OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
| OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
| orthoMCL |
0 | 0.000 |
Not matched by this tool. |
| Panther |
1 |
1.100 |
- |
- |
P |
PTHR10380 |
| Phylome |
1 |
0.910 |
- |
- |
|
|
| RoundUp |
0 | 0.000 |
Not matched by this tool. |
| SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
4 | 3.920 |
|
Return to query results.
Submit another query.