DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr49Ah and Cpr65Eb

DIOPT Version :9

Sequence 1:NP_610777.1 Gene:Cpr49Ah / 36354 FlyBaseID:FBgn0033731 Length:190 Species:Drosophila melanogaster
Sequence 2:NP_648076.3 Gene:Cpr65Eb / 38774 FlyBaseID:FBgn0035736 Length:179 Species:Drosophila melanogaster


Alignment Length:111 Identity:41/111 - (36%)
Similarity:57/111 - (51%) Gaps:19/111 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 DKPDHHRHEDHRETSTWIPIIKYNKEQSDDGSYKTEYETGNSIIHEETGFLKDFDTNPNGVLVQH 98
            |.||     .|.|..:::     |:.:.:||.|..::||.|.|..:|.|.         |.....
  Fly    24 DSPD-----AHAEIRSFV-----NELKQEDGIYNYQFETSNGIAQQEQGV---------GGYYAS 69

  Fly    99 GQYSYQSPEGTLVNVQYTADENGFRATGDHIPTPPAIPEEIQKGLD 144
            |...|.:|||.|:.:.||||||||:..|:|:|||..|||.|.|.|:
  Fly    70 GSSQYYTPEGQLIQLTYTADENGFQPQGEHLPTPHPIPEAILKSLE 115

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr49AhNP_610777.1 Chitin_bind_4 66..122 CDD:395303 20/55 (36%)
Cpr65EbNP_648076.3 Chitin_bind_4 46..93 CDD:278791 20/55 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2EQ63
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1459720at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10380
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.