DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr49Ah and Cpr65Eb

DIOPT Version :10

Sequence 1:NP_610777.1 Gene:Cpr49Ah / 36354 FlyBaseID:FBgn0033731 Length:190 Species:Drosophila melanogaster
Sequence 2:NP_648076.3 Gene:Cpr65Eb / 38774 FlyBaseID:FBgn0035736 Length:179 Species:Drosophila melanogaster


Alignment Length:111 Identity:41/111 - (36%)
Similarity:57/111 - (51%) Gaps:19/111 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 DKPDHHRHEDHRETSTWIPIIKYNKEQSDDGSYKTEYETGNSIIHEETGFLKDFDTNPNGVLVQH 98
            |.||     .|.|..:::     |:.:.:||.|..::||.|.|..:|.|.         |.....
  Fly    24 DSPD-----AHAEIRSFV-----NELKQEDGIYNYQFETSNGIAQQEQGV---------GGYYAS 69

  Fly    99 GQYSYQSPEGTLVNVQYTADENGFRATGDHIPTPPAIPEEIQKGLD 144
            |...|.:|||.|:.:.||||||||:..|:|:|||..|||.|.|.|:
  Fly    70 GSSQYYTPEGQLIQLTYTADENGFQPQGEHLPTPHPIPEAILKSLE 115

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr49AhNP_610777.1 Chitin_bind_4 66..122 CDD:459790 20/55 (36%)
Cpr65EbNP_648076.3 Chitin_bind_4 46..93 CDD:459790 20/55 (36%)

Return to query results.
Submit another query.