DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr49Ah and Acp65Aa

DIOPT Version :10

Sequence 1:NP_610777.1 Gene:Cpr49Ah / 36354 FlyBaseID:FBgn0033731 Length:190 Species:Drosophila melanogaster
Sequence 2:NP_477282.2 Gene:Acp65Aa / 38710 FlyBaseID:FBgn0020765 Length:105 Species:Drosophila melanogaster


Alignment Length:80 Identity:21/80 - (26%)
Similarity:42/80 - (52%) Gaps:1/80 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 IPIIKYNKEQSDDGSYKTEYETGNSIIHEETGFLKDFDTNPNGVLVQHGQYSYQSPEGTLVNVQY 115
            :.:::|..|.:..|.||..|:..:.....|.|.:.:..|:...:.:: |..::.:|:|....:.:
  Fly    26 VEVLEYESENTGLGGYKFSYKLSDGTSRTEEGVVNNAGTDNESISIR-GSVTWVAPDGQTYTINF 89

  Fly   116 TADENGFRATGDHIP 130
            .||||||:..|.|:|
  Fly    90 VADENGFQPEGAHLP 104

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr49AhNP_610777.1 Chitin_bind_4 66..122 CDD:459790 13/55 (24%)
Acp65AaNP_477282.2 Chitin_bind_4 41..96 CDD:459790 13/55 (24%)

Return to query results.
Submit another query.