DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr49Ah and Lcp65Ag1

DIOPT Version :8

Sequence 1:NP_610777.1 Gene:Cpr49Ah / 36354 FlyBaseID:FBgn0033731 Length:190 Species:Drosophila melanogaster
Sequence 2:NP_477273.1 Gene:Lcp65Ag1 / 38703 FlyBaseID:FBgn0020638 Length:105 Species:Drosophila melanogaster

Alignment Length:78 Identity:26/78 - (33%)
Similarity:40/78 - (51%) Gaps:3/78 - (3%)


  Fly    58 KEQSDDG--SYKTEYETGNSIIHEETGFLKDFDTNPNGVLVQHGQYSYQSPEGTLVNVQYTADEN 120
            :.:||.|  |:|.::||.:....:..|.|.|..|....:.|. |.|.:.:.:|....|.|.||:|
  Fly    27 RSESDVGPESFKYDWETSDGQAAQAVGQLNDIGTENEAISVS-GSYRFIADDGQTYQVNYIADKN 90

  Fly   121 GFRATGDHIPTPP 133
            ||:..|.|:|..|
  Fly    91 GFQPQGAHLPVAP 103

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cpr49AhNP_610777.1 Chitin_bind_4 66..122 CDD:278791 16/55 (29%)
Lcp65Ag1NP_477273.1 Chitin_bind_4 37..92 CDD:306811 16/55 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_2EQ63
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR10380
RoundUp 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.