DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr49Ah and Cpr47Ee

DIOPT Version :9

Sequence 1:NP_610777.1 Gene:Cpr49Ah / 36354 FlyBaseID:FBgn0033731 Length:190 Species:Drosophila melanogaster
Sequence 2:NP_610659.1 Gene:Cpr47Ee / 36193 FlyBaseID:FBgn0033602 Length:369 Species:Drosophila melanogaster

Alignment Length:220 Identity:55/220 - (25%)
Similarity:83/220 - (37%) Gaps:72/220 - (32%)


  Fly    19 HHQHQHQNVNNIPRDDKPDHHRHEDHRETSTWIPIIKYNKEQSDDGSYKTEYETGNSIIHEETGF 83
            ::|:|.||                       ::||..|..|.:.|||:...|.:.:....:..|:
  Fly    96 YNQYQQQN-----------------------YVPITAYQNELNLDGSFSYGYSSADGTTAQAQGY 137

  Fly    84 LKDFDTNPNGVLVQ--HGQYSYQSPEGTLVNVQYTADENGFRATGDHIPTPP---AIPEEIQKGL 143
            :|:.... .||..|  .|.|||.|||||.:.|:|.||||||||.|..||:.|   |..:..|:||
  Fly   138 VKNLGYG-EGVEAQVIQGSYSYTSPEGTPITVRYIADENGFRAEGTGIPSSPQYFAGAQPYQQGL 201

  Fly   144 ------------------------------DQIYAGIKLQQERLEQRAKTDPDFARK-------- 170
                                          .|....::.||::.:|:.:....|.::        
  Fly   202 LNPNLNPYQTPFRQLPPPLPNAPFRPQLPGQQPLTPLQQQQQQQQQQLQQQRGFQQQQQPNSGQY 266

  Fly   171 -----LEERRVANQNGQYIGLLENQ 190
                 ..:....|..|||.|....|
  Fly   267 QPEQPFNQLHSGNLPGQYAGQFGQQ 291

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cpr49AhNP_610777.1 Chitin_bind_4 66..122 CDD:395303 21/57 (37%)
Cpr47EeNP_610659.1 Chitin_bind_4 120..177 CDD:278791 21/57 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2EQ63
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1459720at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10380
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.