DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr49Ah and Cpr47Ee

DIOPT Version :8

Sequence 1:NP_610777.1 Gene:Cpr49Ah / 36354 FlyBaseID:FBgn0033731 Length:190 Species:Drosophila melanogaster
Sequence 2:NP_610659.1 Gene:Cpr47Ee / 36193 FlyBaseID:FBgn0033602 Length:369 Species:Drosophila melanogaster

Alignment Length:220 Identity:55/220 - (25%)
Similarity:83/220 - (37%) Gaps:72/220 - (32%)


  Fly    19 HHQHQHQNVNNIPRDDKPDHHRHEDHRETSTWIPIIKYNKEQSDDGSYKTEYETGNSIIHEETGF 83
            ::|:|.||                       ::||..|..|.:.|||:...|.:.:....:..|:
  Fly    96 YNQYQQQN-----------------------YVPITAYQNELNLDGSFSYGYSSADGTTAQAQGY 137

  Fly    84 LKDFDTNPNGVLVQ--HGQYSYQSPEGTLVNVQYTADENGFRATGDHIPTPP---AIPEEIQKGL 143
            :|:.... .||..|  .|.|||.|||||.:.|:|.||||||||.|..||:.|   |..:..|:||
  Fly   138 VKNLGYG-EGVEAQVIQGSYSYTSPEGTPITVRYIADENGFRAEGTGIPSSPQYFAGAQPYQQGL 201

  Fly   144 ------------------------------DQIYAGIKLQQERLEQRAKTDPDFARK-------- 170
                                          .|....::.||::.:|:.:....|.::        
  Fly   202 LNPNLNPYQTPFRQLPPPLPNAPFRPQLPGQQPLTPLQQQQQQQQQQLQQQRGFQQQQQPNSGQY 266

  Fly   171 -----LEERRVANQNGQYIGLLENQ 190
                 ..:....|..|||.|....|
  Fly   267 QPEQPFNQLHSGNLPGQYAGQFGQQ 291

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cpr49AhNP_610777.1 Chitin_bind_4 66..122 CDD:278791 21/57 (37%)
Cpr47EeNP_610659.1 Chitin_bind_4 120..177 CDD:278791 21/57 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_2EQ63
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR10380
RoundUp 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.