DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr49Ah and Lcp4

DIOPT Version :8

Sequence 1:NP_610777.1 Gene:Cpr49Ah / 36354 FlyBaseID:FBgn0033731 Length:190 Species:Drosophila melanogaster
Sequence 2:NP_001260804.1 Gene:Lcp4 / 35820 FlyBaseID:FBgn0002535 Length:112 Species:Drosophila melanogaster

Alignment Length:99 Identity:37/99 - (37%)
Similarity:49/99 - (49%) Gaps:13/99 - (13%)


  Fly    52 PIIK--YNKEQSDDGSYKTEYETGNSIIHEETGFLKDFDTNPNGVLVQHGQYSYQSPEGTLVNVQ 114
            |.:|  .|..|:|....|...:.|::.  ..||   |...|.:||      :.:.||||..|.|.
  Fly    20 PEVKELVNDVQADGFVSKLVLDNGSAA--SATG---DVHGNIDGV------FEWVSPEGEHVRVS 73

  Fly   115 YTADENGFRATGDHIPTPPAIPEEIQKGLDQIYA 148
            |.|||||::...|.:||||.|||.|.|.:..|.|
  Fly    74 YKADENGYQPQSDLLPTPPPIPEAILKAIAYIQA 107

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cpr49AhNP_610777.1 Chitin_bind_4 66..122 CDD:278791 19/55 (35%)
Lcp4NP_001260804.1 Chitin_bind_4 40..81 CDD:278791 18/51 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR10380
RoundUp 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.