DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr49Ah and CG15756

DIOPT Version :8

Sequence 1:NP_610777.1 Gene:Cpr49Ah / 36354 FlyBaseID:FBgn0033731 Length:190 Species:Drosophila melanogaster
Sequence 2:NP_572895.1 Gene:CG15756 / 32308 FlyBaseID:FBgn0030493 Length:298 Species:Drosophila melanogaster

Alignment Length:221 Identity:48/221 - (21%)
Similarity:69/221 - (31%) Gaps:74/221 - (33%)


  Fly     1 MKVLILLVLL---------------------AISCQGQHHHQHQHQNVNNIPRDDKPDHH----- 39
            |..|.:|:||                     :|:......|||.|.....:....:|...     
  Fly    18 MVTLAILLLLQPVDARWTRRPRRTTTPRSTTSITTANPDRHQHVHHWPPLVAPPPQPQPQPPVVV 82

  Fly    40 -RHEDHRETSTWIPIIKYNKEQSDDGSYKTEYETGNSIIHEETGFL----KDFDTNPNGVLVQHG 99
             :...|.|||.  .::....::|.||.|:..|:..|.....|..:.    ||.      ||.:.|
  Fly    83 VQKPSHTETSP--RLVDSFDQRSLDGQYEFRYQLDNGNTRYERAYWLPVGKDL------VLAKKG 139

  Fly   100 QYSYQSPEGTLVNVQYTADENGFRATGDHIPTPPAIPEEIQKGLDQIYAGIKLQQERLEQRAKTD 164
            .||...|......|.||||..|:.                          :.:|...:||     
  Fly   140 YYSVPLPNDKYSTVFYTADHRGYH--------------------------VDMQTLSVEQ----- 173

  Fly   165 PDFARKLE----ERRVANQNGQYIGL 186
            |...|.||    ||.|.:..|...|:
  Fly   174 PLLPRSLEVPGVERDVGSGMGMGTGI 199

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cpr49AhNP_610777.1 Chitin_bind_4 66..122 CDD:278791 17/59 (29%)
CG15756NP_572895.1 Chitin_bind_4 108..162 CDD:278791 17/59 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR10380
RoundUp 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.